Clone FI07205 Report

Search the DGRC for FI07205

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:5
Vector:pFlc-1
Associated Gene/TranscriptPlip-RB
Protein status:FI07205.pep: gold
Sequenced Size:916

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Plip 2008-08-15 Release 5.9 accounting
Plip 2008-12-18 5.12 accounting

Clone Sequence Records

FI07205.complete Sequence

916 bp assembled on 2008-07-29

GenBank Submission: BT044310.1

> FI07205.complete
TGTTGTGCAAAGGAACGCGCAGAGTTTAACCAGAAGGAAATCTGAATTGG
AACTGTTGACGCGCAATCGAAAGTGATAATTACGAGCGGGAATAATTAGA
ATACGAGGAAGATTTCCGCCCGTGTGAATCACCAACTTTTGTCTCGTCCA
ATCCAAGTCAGCCACTGAGCAGCCGGCATGGAGATGAGTGCTGCCATGTT
CGCACGCGTTTCCTTCTACCCCACCCTGCTGTACAATGTCCTGATGGAAA
AGGCATCGGCCAGGAATTGGTACGATCGCATCGATGAGCATGTGATACTG
GGAGCACTGCCCTTTCGCAGCCAGGCCAATGACCTCATTGAAAAGGAGAA
CATGAAGGCGGTGGTGTCGATGAACGAGGACTATGAGCTGACCGCCTTCT
CCAACAACACGGAGAAGTGGCGAAAGCTTGGCATTGAGTTCCTGCAGCTG
GCCACCACCGACATCTTTGAGTCGCCCAATCAAGAAAAGCTCTTCCGCGG
CGTGGAATTCATAAACAAGTTCCTGCCTCTAAAGCAAAGAATTGGTGGCC
TAAGTTCCTCCTACCAGCCGGAGAACGTGGGTTCTGTCTATGTGCACTGC
AAGGCTGGTAGGACGCGAAGTGCCACTTTGGTGGGATGCTACCTCATGAT
GAAGAACGGATGGACTCCGGATCAGGCGGTTGACCACATGCGTAAGTGCC
GACCGCACATTCTGCTGCACACCAAACAATGGGATGCCCTCCGGTTATTC
TACACAAACAATGTGGAGACGAAATCATGACCAAACCTGGACAATAGCCC
AAATTTATTGTTTACAGTAGATTACCATACGTAACAAAGGTGGTGCCTGT
TACCCAACTACTTTAGTGCTGATTTTCTTGTTGAATATACAATTTTCTAC
AAAAAAAAAAAAAAAA

FI07205.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Plip-RB 1077 Plip-RB 166..1068 2..904 4500 99.8 Plus
Plip.a 932 Plip.a 24..923 2..904 4430 99.5 Plus
Plip-RA 957 Plip-RA 234..948 190..904 3575 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19582386..19582703 334..651 1590 100 Plus
chr3R 27901430 chr3R 19582765..19583014 651..900 1250 100 Plus
chr3R 27901430 chr3R 19581749..19581937 2..190 915 98.9 Plus
chr3R 27901430 chr3R 19582183..19582326 190..333 690 98.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:17:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23758978..23759295 334..651 1590 100 Plus
3R 32079331 3R 23759357..23759610 651..904 1270 100 Plus
3R 32079331 3R 23758341..23758529 2..190 930 99.5 Plus
3R 32079331 3R 23758775..23758918 190..333 720 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23499809..23500126 334..651 1590 100 Plus
3R 31820162 3R 23500188..23500441 651..904 1270 100 Plus
3R 31820162 3R 23499172..23499360 2..190 930 99.4 Plus
3R 31820162 3R 23499606..23499749 190..333 720 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:56:30 has no hits.

FI07205.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:57:41 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19581747..19581936 1..189 98 -> Plus
chr3R 19582183..19582326 190..333 98 -> Plus
chr3R 19582386..19582703 334..651 100 -> Plus
chr3R 19582766..19583014 652..900 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:54:56 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..603 178..780 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:23 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..603 178..780 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:59:30 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..603 178..780 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:51 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..603 178..780 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:49:49 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..603 178..780 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:21 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..899 2..900 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:23 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..899 2..900 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:59:30 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..901 1..900 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:44 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..899 2..900 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:49:49 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
Plip-RB 1..901 1..900 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:57:41 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23758775..23758918 190..333 100 -> Plus
3R 23758339..23758528 1..189 98 -> Plus
3R 23758978..23759295 334..651 100 -> Plus
3R 23759358..23759606 652..900 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:57:41 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23758775..23758918 190..333 100 -> Plus
3R 23758339..23758528 1..189 98 -> Plus
3R 23758978..23759295 334..651 100 -> Plus
3R 23759358..23759606 652..900 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:57:41 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23758775..23758918 190..333 100 -> Plus
3R 23758339..23758528 1..189 98 -> Plus
3R 23758978..23759295 334..651 100 -> Plus
3R 23759358..23759606 652..900 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:59:30 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19584497..19584640 190..333 100 -> Plus
arm_3R 19584061..19584250 1..189 98 -> Plus
arm_3R 19584700..19585017 334..651 100 -> Plus
arm_3R 19585080..19585328 652..900 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:54 Download gff for FI07205.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23499809..23500126 334..651 100 -> Plus
3R 23500189..23500437 652..900 100   Plus
3R 23499170..23499359 1..189 98 -> Plus
3R 23499606..23499749 190..333 100 -> Plus

FI07205.hyp Sequence

Translation from 177 to 779

> FI07205.hyp
MEMSAAMFARVSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQA
NDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFESP
NQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSAT
LVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTNNVETKS
*

FI07205.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Plip-PB 200 CG10371-PB 1..200 1..200 1054 100 Plus
Plip-PA 194 CG10371-PA 1..194 7..200 1027 100 Plus

FI07205.pep Sequence

Translation from 177 to 779

> FI07205.pep
MEMSAAMFARVSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQA
NDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFESP
NQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSAT
LVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTNNVETKS
*

FI07205.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16260-PA 200 GF16260-PA 1..200 1..200 1025 92.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:32:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11227-PA 200 GG11227-PA 1..200 1..200 1069 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23609-PA 194 GH23609-PA 1..194 7..200 939 86.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
PTPMT1-PB 200 CG10371-PB 1..200 1..200 1054 100 Plus
PTPMT1-PA 194 CG10371-PA 1..194 7..200 1027 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10365-PA 200 GI10365-PA 1..200 1..200 947 85 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23260-PA 200 GL23260-PA 1..200 1..200 1008 91 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:32:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10281-PA 200 GA10281-PA 1..200 1..200 999 90 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26529-PA 200 GM26529-PA 1..200 1..200 1081 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21036-PA 200 GD21036-PA 1..200 1..200 1086 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22584-PA 200 GJ22584-PA 1..200 1..200 962 87 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:32:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22417-PA 201 GK22417-PA 1..201 1..200 927 82.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10393-PA 200 GE10393-PA 1..200 1..200 1076 98 Plus