BDGP Sequence Production Resources |
Search the DGRC for FI07205
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 72 |
Well: | 5 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Plip-RB |
Protein status: | FI07205.pep: gold |
Sequenced Size: | 916 |
Gene | Date | Evidence |
---|---|---|
Plip | 2008-08-15 | Release 5.9 accounting |
Plip | 2008-12-18 | 5.12 accounting |
916 bp assembled on 2008-07-29
GenBank Submission: BT044310.1
> FI07205.complete TGTTGTGCAAAGGAACGCGCAGAGTTTAACCAGAAGGAAATCTGAATTGG AACTGTTGACGCGCAATCGAAAGTGATAATTACGAGCGGGAATAATTAGA ATACGAGGAAGATTTCCGCCCGTGTGAATCACCAACTTTTGTCTCGTCCA ATCCAAGTCAGCCACTGAGCAGCCGGCATGGAGATGAGTGCTGCCATGTT CGCACGCGTTTCCTTCTACCCCACCCTGCTGTACAATGTCCTGATGGAAA AGGCATCGGCCAGGAATTGGTACGATCGCATCGATGAGCATGTGATACTG GGAGCACTGCCCTTTCGCAGCCAGGCCAATGACCTCATTGAAAAGGAGAA CATGAAGGCGGTGGTGTCGATGAACGAGGACTATGAGCTGACCGCCTTCT CCAACAACACGGAGAAGTGGCGAAAGCTTGGCATTGAGTTCCTGCAGCTG GCCACCACCGACATCTTTGAGTCGCCCAATCAAGAAAAGCTCTTCCGCGG CGTGGAATTCATAAACAAGTTCCTGCCTCTAAAGCAAAGAATTGGTGGCC TAAGTTCCTCCTACCAGCCGGAGAACGTGGGTTCTGTCTATGTGCACTGC AAGGCTGGTAGGACGCGAAGTGCCACTTTGGTGGGATGCTACCTCATGAT GAAGAACGGATGGACTCCGGATCAGGCGGTTGACCACATGCGTAAGTGCC GACCGCACATTCTGCTGCACACCAAACAATGGGATGCCCTCCGGTTATTC TACACAAACAATGTGGAGACGAAATCATGACCAAACCTGGACAATAGCCC AAATTTATTGTTTACAGTAGATTACCATACGTAACAAAGGTGGTGCCTGT TACCCAACTACTTTAGTGCTGATTTTCTTGTTGAATATACAATTTTCTAC AAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 19582386..19582703 | 334..651 | 1590 | 100 | Plus |
chr3R | 27901430 | chr3R | 19582765..19583014 | 651..900 | 1250 | 100 | Plus |
chr3R | 27901430 | chr3R | 19581749..19581937 | 2..190 | 915 | 98.9 | Plus |
chr3R | 27901430 | chr3R | 19582183..19582326 | 190..333 | 690 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 23758978..23759295 | 334..651 | 1590 | 100 | Plus |
3R | 32079331 | 3R | 23759357..23759610 | 651..904 | 1270 | 100 | Plus |
3R | 32079331 | 3R | 23758341..23758529 | 2..190 | 930 | 99.5 | Plus |
3R | 32079331 | 3R | 23758775..23758918 | 190..333 | 720 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 23499809..23500126 | 334..651 | 1590 | 100 | Plus |
3R | 31820162 | 3R | 23500188..23500441 | 651..904 | 1270 | 100 | Plus |
3R | 31820162 | 3R | 23499172..23499360 | 2..190 | 930 | 99.4 | Plus |
3R | 31820162 | 3R | 23499606..23499749 | 190..333 | 720 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 19581747..19581936 | 1..189 | 98 | -> | Plus |
chr3R | 19582183..19582326 | 190..333 | 98 | -> | Plus |
chr3R | 19582386..19582703 | 334..651 | 100 | -> | Plus |
chr3R | 19582766..19583014 | 652..900 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..603 | 178..780 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..603 | 178..780 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..603 | 178..780 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..603 | 178..780 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..603 | 178..780 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..899 | 2..900 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..899 | 2..900 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..901 | 1..900 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..899 | 2..900 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Plip-RB | 1..901 | 1..900 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23758775..23758918 | 190..333 | 100 | -> | Plus |
3R | 23758339..23758528 | 1..189 | 98 | -> | Plus |
3R | 23758978..23759295 | 334..651 | 100 | -> | Plus |
3R | 23759358..23759606 | 652..900 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23758775..23758918 | 190..333 | 100 | -> | Plus |
3R | 23758339..23758528 | 1..189 | 98 | -> | Plus |
3R | 23758978..23759295 | 334..651 | 100 | -> | Plus |
3R | 23759358..23759606 | 652..900 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23758775..23758918 | 190..333 | 100 | -> | Plus |
3R | 23758339..23758528 | 1..189 | 98 | -> | Plus |
3R | 23758978..23759295 | 334..651 | 100 | -> | Plus |
3R | 23759358..23759606 | 652..900 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 19584497..19584640 | 190..333 | 100 | -> | Plus |
arm_3R | 19584061..19584250 | 1..189 | 98 | -> | Plus |
arm_3R | 19584700..19585017 | 334..651 | 100 | -> | Plus |
arm_3R | 19585080..19585328 | 652..900 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 23499809..23500126 | 334..651 | 100 | -> | Plus |
3R | 23500189..23500437 | 652..900 | 100 | Plus | |
3R | 23499170..23499359 | 1..189 | 98 | -> | Plus |
3R | 23499606..23499749 | 190..333 | 100 | -> | Plus |
Translation from 177 to 779
> FI07205.hyp MEMSAAMFARVSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQA NDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFESP NQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSAT LVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTNNVETKS *
Translation from 177 to 779
> FI07205.pep MEMSAAMFARVSFYPTLLYNVLMEKASARNWYDRIDEHVILGALPFRSQA NDLIEKENMKAVVSMNEDYELTAFSNNTEKWRKLGIEFLQLATTDIFESP NQEKLFRGVEFINKFLPLKQRIGGLSSSYQPENVGSVYVHCKAGRTRSAT LVGCYLMMKNGWTPDQAVDHMRKCRPHILLHTKQWDALRLFYTNNVETKS *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16260-PA | 200 | GF16260-PA | 1..200 | 1..200 | 1025 | 92.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11227-PA | 200 | GG11227-PA | 1..200 | 1..200 | 1069 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23609-PA | 194 | GH23609-PA | 1..194 | 7..200 | 939 | 86.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
PTPMT1-PB | 200 | CG10371-PB | 1..200 | 1..200 | 1054 | 100 | Plus |
PTPMT1-PA | 194 | CG10371-PA | 1..194 | 7..200 | 1027 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10365-PA | 200 | GI10365-PA | 1..200 | 1..200 | 947 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23260-PA | 200 | GL23260-PA | 1..200 | 1..200 | 1008 | 91 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10281-PA | 200 | GA10281-PA | 1..200 | 1..200 | 999 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26529-PA | 200 | GM26529-PA | 1..200 | 1..200 | 1081 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21036-PA | 200 | GD21036-PA | 1..200 | 1..200 | 1086 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22584-PA | 200 | GJ22584-PA | 1..200 | 1..200 | 962 | 87 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22417-PA | 201 | GK22417-PA | 1..201 | 1..200 | 927 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10393-PA | 200 | GE10393-PA | 1..200 | 1..200 | 1076 | 98 | Plus |