Clone FI07210 Report

Search the DGRC for FI07210

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:10
Vector:pFlc-1
Associated Gene/TranscriptMED8-RA
Protein status:FI07210.pep: gold
Sequenced Size:981

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
MED8 2008-12-18 5.12 accounting

Clone Sequence Records

FI07210.complete Sequence

981 bp assembled on 2008-11-04

GenBank Submission: BT050506.1

> FI07210.complete
AATATGCAGATCCACGGTCACACTTTCCACTTTGTGTCCATCCGACTGAA
GTTAAAAATAATAGTTTAATTGGGAGTTTCCAAAATGCAGCGCGACGAAA
AGCTTTTTGAGCTGACGCTGGATACGGTCCTTCAGCGTCTGAACGACCTG
AAGCTGGCGGTTCTCTCGATGATCCAAAAACTTGAGCTAGAGTACGAGAC
CATCAACTGGCCGACTTTCCTGGACAACTTTGCCATTATCTCAAGTCACT
TGACGGGATTGACGAAAATCTTGGCAAAGGAGCAGTGTCCGCCGCTAAGA
AATCGAACGGTCCTGCCCCTTCTGGTCTCCATGGACCGGGATGACACCCT
CATCAACATCACAGAGGGTCGGGTGCCAGTCTTTTCACACGACATTGTTC
CAGACTATTTGAGAACTCGGCCGGATCCGATTACGGAACAGAAAATGCTG
CAGAACGAACAGAAGGCGGCGAACCTCACCAACGACGCTGCCATGAAACA
GGTCACTCAATACAACAAGGTCGTCTCCCACGTCCTGGATATGGTCAGCA
AAGCGCGCGAGGAGTGGGAAATCGAGAGCTCTTCGCGCACCGGCATCCAG
CAGACGAGTAGCATGGCCGACACACAGCTCCTGGTGGCCGCCGTGGGTAT
GGGAAAAGGACTCAAGCTGACCAACTATGGACCCGGACCTGGCATGATGG
TACCGCCTTCAATTCGAGCACCCTCGCCAATGGGTGGACCCGCTATGAGT
CCCGGCAACGTGCAGCAGCAGCTGGGAAAGGCGCCATCGGCTGTGAAAAC
AAACATCAAGTCCGCAAATCAAGTGCATCCGTTCTCTCGATAAAAAACAT
CAGTTTATTAGCTATTATCGGTTCCATCTGGCGGAATGTTTCGTCGTAAT
AAGTTATATGTATATTCCTAATTCTAAAACTAGGATTACGCAAACATAAA
CATGAACAAATTTCCCAAAAAAAAAAAAAAA

FI07210.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
MED8-RA 966 MED8-RA 1..963 1..963 4800 99.8 Plus
CG8920.d 4012 CG8920.d 3883..4012 963..834 650 100 Minus
CG8920-RC 4026 CG8920-RC 3897..4026 963..834 650 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16212857..16213819 963..1 4680 99.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:15:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20325844..20326806 963..1 4800 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20327043..20328005 963..1 4800 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 17:15:15 has no hits.

FI07210.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:15:57 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16212854..16213819 1..966 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:01 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..759 85..843 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:18:15 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..759 85..843 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:47 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..759 85..843 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:55:37 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..759 85..843 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:58:35 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..963 1..966 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:18:15 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..963 1..966 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:47 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..963 1..963 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-11-04 14:10:02 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..963 1..966 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:55:37 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
MED8-RA 1..963 1..963 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:15:57 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20325841..20326806 1..966 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:15:57 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20325841..20326806 1..966 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:15:57 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20325841..20326806 1..966 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:47 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16213346..16214311 1..966 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:49:27 Download gff for FI07210.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20327040..20328005 1..966 99   Minus

FI07210.pep Sequence

Translation from 84 to 842

> FI07210.pep
MQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFA
IISSHLTGLTKILAKEQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVF
SHDIVPDYLRTRPDPITEQKMLQNEQKAANLTNDAAMKQVTQYNKVVSHV
LDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKLTNYGP
GPGMMVPPSIRAPSPMGGPAMSPGNVQQQLGKAPSAVKTNIKSANQVHPF
SR*

FI07210.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12669-PA 251 GF12669-PA 1..251 1..252 1283 96.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20865-PA 252 GG20865-PA 1..252 1..252 1334 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20059-PA 256 GH20059-PA 1..256 1..252 1138 88.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
MED8-PA 252 CG13867-PA 1..252 1..252 1283 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18776-PA 256 GI18776-PA 1..256 1..252 1218 91 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16821-PA 252 GL16821-PA 1..252 1..252 1286 94.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12583-PA 252 GA12583-PA 1..252 1..252 1286 94.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19790-PA 252 GM19790-PA 1..252 1..252 1333 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25282-PA 252 GD25282-PA 1..252 1..252 1333 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21803-PA 256 GJ21803-PA 1..256 1..252 1222 91.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17848-PA 251 GK17848-PA 1..251 1..252 1154 89.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Arc32-PA 252 GE13805-PA 1..252 1..252 1334 99.6 Plus

FI07210.hyp Sequence

Translation from 84 to 842

> FI07210.hyp
MQRDEKLFELTLDTVLQRLNDLKLAVLSMIQKLELEYETINWPTFLDNFA
IISSHLTGLTKILAKEQCPPLRNRTVLPLLVSMDRDDTLINITEGRVPVF
SHDIVPDYLRTRPDPITEQKMLQNEQKAANLTNDAAMKQVTQYNKVVSHV
LDMVSKAREEWEIESSSRTGIQQTSSMADTQLLVAAVGMGKGLKLTNYGP
GPGMMVPPSIRAPSPMGGPAMSPGNVQQQLGKAPSAVKTNIKSANQVHPF
SR*

FI07210.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
MED8-PA 252 CG13867-PA 1..252 1..252 1283 100 Plus