Clone FI07217 Report

Search the DGRC for FI07217

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:17
Vector:pFlc-1
Associated Gene/TranscriptCG16787-RA
Protein status:FI07217.pep: gold
Sequenced Size:1087

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16787 2008-08-15 Release 5.9 accounting
CG16787 2008-12-18 5.12 accounting

Clone Sequence Records

FI07217.complete Sequence

1087 bp assembled on 2008-07-15

GenBank Submission: BT044314.1

> FI07217.complete
AGGGTCTGGCCACACTGCAGCCCAACGACCATATGATTTTTGCCGAGTAT
TTTATTTCCAAATGTTGTTACCTAAACACGAGCACGTCAAATTCCTGAGG
GCCGCAAACGAAAAATAGCCAGGATCTAAGTTCAATTTGAATGGTGTGAT
CTGCAGACGAGGCAGATCTGAATCGAGGAAACCCAGTTCCGGTGAAGGAA
GTAGCACACAAAGTCCTTGCAAGATGTTGCGAAATTTCGGGATTTCATCA
ATAAGAAGGAGCAGCTGGATGGCCAACTGGTGCTCCAAGGAGCGGGCGTG
GGCGTCCGCCATGCGGCTAAGTGCGTCTGCGCCGGCGAAGTGTCCACAAA
AGTTGTTAAACAGCCATGCCGCCAATAACCTCCAGCAAAGTCGAAGGGCC
TACGAGAGCACCAAAGCGGAGAGGCTGCCCGGGAACCCTAAGGAGAACGA
GCGTAAGCCCGAGGACCTGGATAGAGCCTACGAGGTTCTGAGGACCACGC
TACCAAAGCTGTTCGTGGAGCCCCTAGACTACTCCATTTACAGCCCGGGC
CTAATCTTCCACAACAACATAACGGGCAAGCACACGGTGGGCCTGTACCA
CTACGTCAAACAGATCGCCATCCTGCGAACGGTTGGCCACCTGAAGTACG
CCTACGTGAAATTCGAGGTGCTCAAGATCACGAAGCACCAGGACGACTAC
ACAGTGCGGATAAGGTGGCGAGTGCGCGGCATTTCCGGCCTGAAGGTCAT
GTTCCAGTTCTGGAAGTACAAGCTCTGGCAACTGAAGGAGGTGCTGAAGG
ATCAGGAGGCCTGGTACGACGGCTACTCTGTCTGCTATCTGGGCGACGAT
GGGCTGATCGTCAAGCACGTCGTGGACAAAGTGATGCCGGACGAGAGTCG
GGAGGCGGTTGAGAACCCTTCTGCGACGGCACTACCTCCCGGATCCTTGG
CAGCGACCTCTTCCCAGAAGATCAACTGCCAATGAAGTCGTAGCTAGCTA
GCTTTAAATGTTACTTATTTATTGTATTACTAATCGTAATAAACGCAACT
GTGAGAACGTTTAGTAACCGCAAAAAAAAAAAAAAAA

FI07217.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG16787-RA 1069 CG16787-RA 2..1069 4..1071 5340 100 Plus
thoc5.a 2037 thoc5.a 1964..2037 1072..999 370 100 Minus
thoc5-RA 2048 thoc5-RA 1975..2048 1072..999 370 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:55:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19842411..19843478 1071..4 5220 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23956334..23957402 1072..4 5345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23957533..23958601 1072..4 5345 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:55:27 has no hits.

FI07217.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:56:08 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19842411..19843479 1..1071 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:05 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 1..762 224..985 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:25 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 1..762 224..985 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:41 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 1..762 224..985 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:52:49 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 1..762 224..985 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:44 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 1..762 224..985 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:28:24 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 2..1069 4..1071 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:25 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 2..1069 4..1071 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:41 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 1..1071 1..1071 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:52:49 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 2..1069 4..1071 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:44 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
CG16787-RA 1..1071 1..1071 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:08 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23956335..23957403 1..1071 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:08 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23956335..23957403 1..1071 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:08 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23956335..23957403 1..1071 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:41 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19843858..19844926 1..1071 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:04 Download gff for FI07217.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23957552..23958620 1..1071 99   Minus

FI07217.hyp Sequence

Translation from 223 to 984

> FI07217.hyp
MLRNFGISSIRRSSWMANWCSKERAWASAMRLSASAPAKCPQKLLNSHAA
NNLQQSRRAYESTKAERLPGNPKENERKPEDLDRAYEVLRTTLPKLFVEP
LDYSIYSPGLIFHNNITGKHTVGLYHYVKQIAILRTVGHLKYAYVKFEVL
KITKHQDDYTVRIRWRVRGISGLKVMFQFWKYKLWQLKEVLKDQEAWYDG
YSVCYLGDDGLIVKHVVDKVMPDESREAVENPSATALPPGSLAATSSQKI
NCQ*

FI07217.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG16787-PA 253 CG16787-PA 1..253 1..253 1341 100 Plus

FI07217.pep Sequence

Translation from 223 to 984

> FI07217.pep
MLRNFGISSIRRSSWMANWCSKERAWASAMRLSASAPAKCPQKLLNSHAA
NNLQQSRRAYESTKAERLPGNPKENERKPEDLDRAYEVLRTTLPKLFVEP
LDYSIYSPGLIFHNNITGKHTVGLYHYVKQIAILRTVGHLKYAYVKFEVL
KITKHQDDYTVRIRWRVRGISGLKVMFQFWKYKLWQLKEVLKDQEAWYDG
YSVCYLGDDGLIVKHVVDKVMPDESREAVENPSATALPPGSLAATSSQKI
NCQ*

FI07217.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:58:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12049-PA 253 GF12049-PA 1..253 1..253 1095 79.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19974-PA 253 GG19974-PA 1..253 1..253 1305 94.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:58:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21697-PA 204 GH21697-PA 22..198 75..251 788 79.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG16787-PA 253 CG16787-PA 1..253 1..253 1341 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20710-PA 260 GI20710-PA 10..247 16..251 857 67.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:58:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11183-PA 252 GL11183-PA 1..252 1..253 964 71.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14149-PA 252 GA14149-PA 1..252 1..253 975 72.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15487-PA 253 GM15487-PA 1..253 1..253 1343 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:58:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24989-PA 253 GD24989-PA 1..253 1..253 1350 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20449-PA 260 GJ20449-PA 48..245 56..251 809 75.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15850-PA 196 GK15850-PA 17..196 72..251 833 83.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:58:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11507-PA 253 GE11507-PA 1..253 1..253 1312 94.9 Plus