Clone FI07223 Report

Search the DGRC for FI07223

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:23
Vector:pFlc-1
Associated Gene/TranscriptCG4042-RA
Protein status:FI07223.pep: gold
Sequenced Size:964

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4042 2008-08-15 Release 5.9 accounting
CG4042 2008-12-18 5.12 accounting

Clone Sequence Records

FI07223.complete Sequence

964 bp assembled on 2008-07-29

GenBank Submission: BT044316.1

> FI07223.complete
AAATAATTTATATATTGATATCCCACTCGAAGGATGTTGCAGCGCGTGTC
GCGTAGATTTCCCTCCTTAAGGCGATGCGGCCTGCGAACGGCATCCACTG
TGCCCACAAATCAGGCGCAGCCGGGCGAGGTAGAGGAGGAGGTCAGTGCG
ACGGTGAAGAGAATCCGCTCGGAATTGGCAGCGGATAAGCAGAAACTTAA
GTGGCGCACTCCGATTGGCGACCGGCCGGAGGATTGGAACAGCAAACTGA
AGCTGTTCTCCAATGCGGAGCAAACCTCAGACTTCATCGTGATGATGCAG
AAGCCCATCGATCTAAGTCCGCGGAACATTCGACAGTGGTGGGAGAACCG
GGAGGAGCGTATTGAGCGGCACATGCAGCAGTTTGTCCCGGAAAGGCACA
AGATTCTGGGCGCCGAATTGGCTGCGGCGCATTTCATACTGTACCGCGGC
GGGGCCGTCAAGTTCATCAACGATACCCACTGGCGCCGGGCCTCCAAAGA
TGGCGAGTTCAAACTGCCTAATAAGTTTGATCCTCGCTATAAAGTGGAGG
CCTTGAGGTGTGATAACATGGAACTTTACTACGAGGGGCTGGAGAACCTG
CGCTGCCTGGACTCCCTTAAGTTCCTGTCCTTTCACAATGTGAAAAGCTT
TGATGACTGGTGTCTGGATAGGATTTCGGGAGGTGGCTTCCCTAACCTGG
AAGTGCTCGACCTCTCGTGCACTCAAATCACCAGCAATGGATTGGCCTGT
CTGTATCGTTTTCCTAAACTTAAATTACTGATTTTGAATGATCCAAAGGA
GACCCTAGAACTGGAATTGTCCACGGTCATGTTAGAGGAGGCCATGCCCG
CTTTAAAAATTGTTGGCGCCGACGCTATTCACAGCTAAGGCTAAATAAGT
GAACTATGTGCATTTTAAGTTTAGTTAAATACAAATGTTATTCATAACAA
AAAAAAAAAAAAAA

FI07223.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG4042-RA 981 CG4042-RA 38..981 5..948 4720 100 Plus
CG4042.a 1024 CG4042.a 70..990 33..953 4605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20759165..20760108 948..5 4720 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:59:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20770138..20771086 953..5 4745 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20763238..20764186 953..5 4745 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:59:54 has no hits.

FI07223.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:01:20 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20759165..20760110 1..948 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:10 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 1..855 34..888 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:22 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 1..855 34..888 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:47:40 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 1..855 34..888 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:50 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 1..855 34..888 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:25 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 1..855 34..888 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:20 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 35..981 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:22 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 35..981 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:47:40 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 5..951 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:41 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 35..981 1..948 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:25 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
CG4042-RA 5..951 1..948 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:20 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20770143..20771088 1..948 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:20 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20770143..20771088 1..948 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:20 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20770143..20771088 1..948 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:40 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20763243..20764188 1..948 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:52 Download gff for FI07223.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20763243..20764188 1..948 99   Minus

FI07223.pep Sequence

Translation from 33 to 887

> FI07223.pep
MLQRVSRRFPSLRRCGLRTASTVPTNQAQPGEVEEEVSATVKRIRSELAA
DKQKLKWRTPIGDRPEDWNSKLKLFSNAEQTSDFIVMMQKPIDLSPRNIR
QWWENREERIERHMQQFVPERHKILGAELAAAHFILYRGGAVKFINDTHW
RRASKDGEFKLPNKFDPRYKVEALRCDNMELYYEGLENLRCLDSLKFLSF
HNVKSFDDWCLDRISGGGFPNLEVLDLSCTQITSNGLACLYRFPKLKLLI
LNDPKETLELELSTVMLEEAMPALKIVGADAIHS*

FI07223.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24115-PA 284 GF24115-PA 1..282 1..284 1249 79.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:31:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13287-PA 284 GG13287-PA 1..282 1..284 1381 90.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16756-PA 282 GH16756-PA 4..282 9..283 1092 71.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG4042-PB 284 CG4042-PB 1..284 1..284 1494 100 Plus
CG4042-PA 284 CG4042-PA 1..284 1..284 1494 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:31:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13417-PA 278 GI13417-PA 4..276 7..284 1097 71.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12755-PA 284 GL12755-PA 1..282 1..284 1095 73.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17910-PA 284 GA17910-PA 1..282 1..284 1160 75.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22190-PA 282 GM22190-PA 1..282 1..284 1427 94 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12165-PA 284 GD12165-PA 1..284 1..284 1451 95.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:32:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11542-PA 282 GJ11542-PA 18..279 18..283 1126 75.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12325-PA 283 GK12325-PA 1..278 1..283 1062 69.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22385-PA 283 GE22385-PA 1..283 1..284 1397 91.5 Plus
Dyak\GE22734-PA 283 GE22734-PA 1..283 1..284 1392 91.2 Plus

FI07223.hyp Sequence

Translation from 33 to 887

> FI07223.hyp
MLQRVSRRFPSLRRCGLRTASTVPTNQAQPGEVEEEVSATVKRIRSELAA
DKQKLKWRTPIGDRPEDWNSKLKLFSNAEQTSDFIVMMQKPIDLSPRNIR
QWWENREERIERHMQQFVPERHKILGAELAAAHFILYRGGAVKFINDTHW
RRASKDGEFKLPNKFDPRYKVEALRCDNMELYYEGLENLRCLDSLKFLSF
HNVKSFDDWCLDRISGGGFPNLEVLDLSCTQITSNGLACLYRFPKLKLLI
LNDPKETLELELSTVMLEEAMPALKIVGADAIHS*

FI07223.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG4042-PB 284 CG4042-PB 1..284 1..284 1494 100 Plus
CG4042-PA 284 CG4042-PA 1..284 1..284 1494 100 Plus