Clone FI07228 Report

Search the DGRC for FI07228

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:28
Vector:pFlc-1
Associated Gene/TranscriptProsbeta1-RA
Protein status:FI07228.pep: gold
Sequenced Size:861

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
l(2)05070 2008-08-15 Release 5.9 accounting
l(2)05070 2008-12-18 5.12 accounting

Clone Sequence Records

FI07228.complete Sequence

861 bp assembled on 2008-07-29

GenBank Submission: BT044319.1

> FI07228.complete
AAAAACAAGCCAGTCATTTCGTGTTCGTGCGGCGTTTCAACAAATATCAA
TTGTAAATTGAATTGTAACAAATTTAAAGATCAATATGCAGCCCGACTTT
GATTTCACCGACACACCGGTCAGCACTGGTACCACCATTATGGCAGTGGA
GTTCGATGGCGGAGTGGTCATTGGAGCCGATTCGCGCACCAGCTCGGGCG
CCTATGTTGCCAATCGGGTCACCGACAAGCTGACCCGCATCACGGACAAA
GTGTACTGCTGCCGCAGTGGCTCGGCCGCCGACACCCAGGCCATTGCCGA
CATTGTGGCCTACTCGCTGAACTATCACGAGAATCAGACCAACAAGGATG
CTCTGGTGTTCGAGGCCGCCTCAGAGTTCCGTAATTACTGCTACAGCTAC
CGCGAGTCCCTGCTTGCCGGCATCATTGTGGCTGGGTGGGATGAGCAGCG
CGGCGGCCAGGTGTACAGCATCCCGTTGGGCGGCATGCTGACCCGCGAGT
CCTGCACCATCGGCGGATCGGGATCTAGTTTTATCTACGGATTTGTTAGG
GAGCACTACCGCCCCAATATGGCGCTGGAGGATTGCGTTACATTCGTCAA
GAAGGCTGTCCAGCACGCTATCTACCACGATGGCAGCTCCGGTGGTGTGG
TGCGCATTGGCATCATCACCAAGGATGGCATCGAGCGACGCATCTTCTAC
AACACAGAATCGGGCGCATCGGCTGTTTCCAGCACTCCCAGCTTCATTTC
CTCGGAATAAATAGTATACCTACCCAAGTAAGATCGATCAGAGAAAGAGT
TGCAAACTCGTCTCATGCTAATAAACCTGGTTTTTGTAATATGCATAAAA
AAAAAAAAAAA

FI07228.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta1-RA 949 Prosbeta1-RA 98..943 2..847 4230 100 Plus
CG8389-RB 1925 CG8389-RB 1857..1925 847..779 345 100 Minus
CG8389-RA 1980 CG8389-RA 1912..1980 847..779 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11901383..11901857 605..131 2375 100 Minus
chr2R 21145070 chr2R 11901074..11901315 846..605 1210 100 Minus
chr2R 21145070 chr2R 11901921..11902049 130..2 645 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16014114..16014588 605..131 2375 100 Minus
2R 25286936 2R 16013804..16014046 847..605 1215 100 Minus
2R 25286936 2R 16014652..16014780 130..2 645 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16015313..16015787 605..131 2375 100 Minus
2R 25260384 2R 16015003..16015245 847..605 1215 100 Minus
2R 25260384 2R 16015851..16015979 130..2 645 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:27:31 has no hits.

FI07228.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:28:29 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11901074..11901314 606..846 100 <- Minus
chr2R 11901383..11901857 131..605 100 <- Minus
chr2R 11901921..11902049 1..130 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:13 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05070-RA 1..675 86..760 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:30 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta1-RA 1..675 86..760 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:12:07 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta1-RA 1..675 86..760 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:54 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05070-RA 1..675 86..760 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:28:48 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta1-RA 1..675 86..760 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:31 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05070-RA 1..845 2..846 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:30 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta1-RA 1..845 2..846 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:12:07 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta1-RA 7..852 1..846 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:43 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)05070-RA 1..845 2..846 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:28:48 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta1-RA 7..852 1..846 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:29 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16013805..16014045 606..846 100 <- Minus
2R 16014114..16014588 131..605 100 <- Minus
2R 16014652..16014780 1..130 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:29 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16013805..16014045 606..846 100 <- Minus
2R 16014114..16014588 131..605 100 <- Minus
2R 16014652..16014780 1..130 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:28:29 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16013805..16014045 606..846 100 <- Minus
2R 16014114..16014588 131..605 100 <- Minus
2R 16014652..16014780 1..130 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:12:07 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11901310..11901550 606..846 100 <- Minus
arm_2R 11901619..11902093 131..605 100 <- Minus
arm_2R 11902157..11902285 1..130 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:03 Download gff for FI07228.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16015004..16015244 606..846 100 <- Minus
2R 16015313..16015787 131..605 100 <- Minus
2R 16015851..16015979 1..130 99   Minus

FI07228.pep Sequence

Translation from 85 to 759

> FI07228.pep
MQPDFDFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLT
RITDKVYCCRSGSAADTQAIADIVAYSLNYHENQTNKDALVFEAASEFRN
YCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCTIGGSGSSFI
YGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIE
RRIFYNTESGASAVSSTPSFISSE*

FI07228.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13326-PA 229 GF13326-PA 1..224 1..224 1049 87.9 Plus
Dana\GF19078-PA 569 GF19078-PA 7..214 6..213 779 64.9 Plus
Dana\GF23798-PA 272 GF23798-PA 42..253 18..217 235 26.3 Plus
Dana\GF21212-PA 322 GF21212-PA 47..234 12..200 235 27 Plus
Dana\GF13303-PA 314 GF13303-PA 71..254 15..198 204 29.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22308-PA 224 GG22308-PA 1..224 1..224 1157 97.3 Plus
Dere\GG15711-PA 272 GG15711-PA 42..253 18..217 236 26.8 Plus
Dere\GG18789-PA 307 GG18789-PA 45..230 12..198 225 26.7 Plus
Dere\GG20151-PA 282 GG20151-PA 66..256 1..198 207 29.5 Plus
Dere\GG20051-PA 390 GG20051-PA 67..254 4..198 201 28.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19825-PA 222 GH19825-PA 1..222 1..222 1032 85.6 Plus
Dgri\GH21772-PA 225 GH21772-PA 2..206 4..208 606 55.1 Plus
Dgri\GH12772-PA 300 GH12772-PA 41..237 12..212 244 27.9 Plus
Dgri\GH16666-PA 272 GH16666-PA 42..223 18..200 231 28.4 Plus
Dgri\GH23050-PA 315 GH23050-PA 68..254 12..198 217 29.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta1-PA 224 CG8392-PA 1..224 1..224 1159 100 Plus
Prosbeta2-PA 272 CG3329-PA 34..253 10..217 260 26.7 Plus
Prosbeta2R1-PA 307 CG18341-PA 45..241 12..212 233 27.4 Plus
Prosbeta5-PA 282 CG12323-PA 73..256 15..198 215 28.1 Plus
Prosbeta5-PB 282 CG12323-PB 73..256 15..198 215 28.1 Plus
Prosbeta5R1-PA 315 CG9868-PA 71..254 15..198 210 28.6 Plus
Prosbeta2R2-PA 322 CG12161-PA 47..231 13..197 186 25.8 Plus
Prosbeta5R2-PB 279 CG31742-PB 64..247 1..191 166 26.6 Plus
Prosbeta5R2-PA 279 CG31742-PA 64..247 1..191 166 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:34:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20414-PA 222 GI20414-PA 1..221 1..221 1029 85.1 Plus
Dmoj\GI19318-PA 224 GI19318-PA 9..198 15..204 561 57.4 Plus
Dmoj\GI15360-PA 313 GI15360-PA 41..226 12..198 253 28.3 Plus
Dmoj\GI11352-PA 270 GI11352-PA 34..223 10..200 244 28.8 Plus
Dmoj\GI21121-PA 314 GI21121-PA 71..254 15..198 221 31.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10209-PA 225 GL10209-PA 1..219 1..219 1014 86.3 Plus
Dper\GL26231-PA 238 GL26231-PA 8..227 4..221 655 55.5 Plus
Dper\GL15166-PA 327 GL15166-PA 43..232 10..200 245 29.3 Plus
Dper\GL24711-PA 272 GL24711-PA 42..223 18..200 237 28.4 Plus
Dper\GL11283-PA 305 GL11283-PA 71..238 15..198 171 26.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:34:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21041-PA 225 GA21041-PA 1..219 1..219 1014 86.3 Plus
Dpse\GA28033-PA 238 GA28033-PA 8..227 4..221 659 55.9 Plus
Dpse\GA28089-PA 238 GA28089-PA 8..227 4..221 655 55.5 Plus
Dpse\GA14896-PA 327 GA14896-PA 43..232 10..200 245 29.3 Plus
Dpse\GA17382-PA 272 GA17382-PA 42..223 18..200 236 28.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:34:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20098-PA 224 GM20098-PA 1..224 1..224 1174 98.7 Plus
Dsec\GM12440-PA 307 GM12440-PA 45..241 12..212 236 27.4 Plus
Dsec\GM25498-PA 272 GM25498-PA 42..253 18..217 235 25.8 Plus
Dsec\GM21240-PA 282 GM21240-PA 69..256 4..198 207 29.9 Plus
Dsec\GM15565-PA 315 GM15565-PA 67..254 4..198 202 28.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16019-PA 206 GD16019-PA 1..206 19..224 1080 99 Plus
Dsim\GD16756-PA 307 GD16756-PA 45..241 12..212 235 27.4 Plus
Dsim\GD14518-PA 272 GD14518-PA 42..253 18..217 232 25.4 Plus
Dsim\GD10758-PA 282 GD10758-PA 69..256 4..198 207 29.9 Plus
Dsim\GD19639-PA 322 GD19639-PA 47..231 13..197 172 24.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:34:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20086-PA 222 GJ20086-PA 1..222 1..222 1008 82.9 Plus
Dvir\GJ22197-PA 221 GJ22197-PA 9..194 15..200 590 58.6 Plus
Dvir\GJ16628-PA 304 GJ16628-PA 41..228 12..200 233 26.5 Plus
Dvir\GJ11606-PA 270 GJ11606-PA 40..251 18..217 225 25.4 Plus
Dvir\GJ20967-PA 312 GJ20967-PA 71..254 15..198 197 28.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21488-PA 225 GK21488-PA 3..222 4..221 993 85.5 Plus
Dwil\GK10550-PA 272 GK10550-PA 34..253 10..217 263 28.1 Plus
Dwil\GK25153-PA 353 GK25153-PA 47..230 12..195 224 26.5 Plus
Dwil\GK15836-PA 283 GK15836-PA 69..256 4..198 206 29.4 Plus
Dwil\GK19557-PA 362 GK19557-PA 71..254 15..198 195 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14105-PA 224 GE14105-PA 1..223 1..223 1145 96.4 Plus
Dyak\GE16434-PA 315 GE16434-PA 45..241 12..212 235 26.9 Plus
Dyak\GE22042-PA 272 GE22042-PA 42..253 18..217 232 25.8 Plus
Dyak\Prosbeta5-PA 282 GE12841-PA 69..256 4..198 206 29.9 Plus
Dyak\GE11586-PA 315 GE11586-PA 71..254 15..198 200 28.6 Plus

FI07228.hyp Sequence

Translation from 85 to 759

> FI07228.hyp
MQPDFDFTDTPVSTGTTIMAVEFDGGVVIGADSRTSSGAYVANRVTDKLT
RITDKVYCCRSGSAADTQAIADIVAYSLNYHENQTNKDALVFEAASEFRN
YCYSYRESLLAGIIVAGWDEQRGGQVYSIPLGGMLTRESCTIGGSGSSFI
YGFVREHYRPNMALEDCVTFVKKAVQHAIYHDGSSGGVVRIGIITKDGIE
RRIFYNTESGASAVSSTPSFISSE*

FI07228.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta1-PA 224 CG8392-PA 1..224 1..224 1159 100 Plus
Prosbeta2-PA 272 CG3329-PA 34..253 10..217 260 26.7 Plus
Prosbeta2R1-PA 307 CG18341-PA 45..241 12..212 233 27.4 Plus
Prosbeta5-PA 282 CG12323-PA 73..256 15..198 215 28.1 Plus
Prosbeta5-PB 282 CG12323-PB 73..256 15..198 215 28.1 Plus