Clone FI07231 Report

Search the DGRC for FI07231

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:31
Vector:pFlc-1
Associated Gene/TranscriptTpnC4-RA
Protein status:FI07231.pep: gold
Sequenced Size:877

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
TpnC4 2008-08-15 Release 5.9 accounting
TpnC4 2008-12-18 5.12 accounting

Clone Sequence Records

FI07231.complete Sequence

877 bp assembled on 2008-07-31

GenBank Submission: BT044320.1

> FI07231.complete
AAAAAAAAAAAAAAAGCTTGGTGATAATTGAAAGTAGCGTACCCTGTTTC
TTTAGCTCCTCTTCTGGGACACTTTTTAGATTATCAAAAATATCGTATAG
TAATAGTAATATAGTATTTTTATATTATATTTAAAGGGTTTTCCTAAACC
TTAGCGGTGTAATTTGATTTAACAAAAAAAAACTCTTTAAAATGGCCGAT
GGAGAATACGACAAGGAACAATTGAGAATCCTTAGGAACGCCTTCAAGGC
TTTCGACCACGACGGTGCAGGATCGATCGAACATGCTGATGTATCTAGCA
TTCTTGAAATTTTGGGTCAGAAATTAGAACCACCTGCGGTAAAGGCCCTT
ATTAAAGAGGTCGATAAAGGAACAACTGGTAAATTGGATTTTAGCCAGTT
CTGCAAACTGGCAGCTCGCTTTATTGAAGTTGAGGAAGATGTGGGAGCTC
TTCAAAATGAGTTAAAAGAGGCCTTCCGTGTATATGATAAAGAGGGGAAA
GGATACCTGACAGTTGCAACACTAAGAGGCATTCTTCACGAATTGGACGA
TAAGCTTTCTAACCAAGACTTAGATATGATTATAGAAGAAATTGATGCGG
ATGGATCCGGTACGGTTGATTTTGACGAATTCATGCAAGTTATGACAGGT
TGACCCACATTGCTCTTTTTTGACATGCTGTGCAAAAGCTCAGATATGGC
AGACAATGCAAAATCAAAAATACATAAAACAATAATAGCCATTAGTTTTG
TGTCAAATATTATAAATAAAATTTGATTGAAATGTATTAGCATCATTTTT
CTCTTATCTAATTTAAATATAAACAAATATCGGGCCAAAAGCAGATAAGG
CCGATGTACGGAAAAAAAAAAAAAAAA

FI07231.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC4-RA 849 TpnC4-RA 1..849 12..860 4245 100 Plus
TpnC4.a 1075 TpnC4.a 1..849 12..860 4245 100 Plus
TpnC4-RB 810 TpnC4-RB 77..810 127..860 3625 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:06:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 1393660..1394058 627..229 1995 100 Minus
chr2R 21145070 chr2R 1390801..1391015 860..646 1075 100 Minus
chr2R 21145070 chr2R 1395029..1395212 195..12 920 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 5506313..5506711 627..229 1995 100 Minus
2R 25286936 2R 5503437..5503651 860..646 1075 100 Minus
2R 25286936 2R 5507683..5507866 195..12 920 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 5507512..5507910 627..229 1995 100 Minus
2R 25260384 2R 5504636..5504850 860..646 1075 100 Minus
2R 25260384 2R 5508882..5509065 195..12 920 100 Minus
2R 25260384 2R 5507960..5507994 228..194 175 100 Minus
Blast to na_te.dros performed 2019-03-16 21:06:46
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 5283..5365 692..776 123 65.5 Plus
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 447..496 718..767 114 74.5 Plus

FI07231.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:07:30 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 1390800..1391012 649..861 99 <- Minus
chr2R 1393585..1393605 628..648 95 <- Minus
chr2R 1393660..1394058 229..627 100 <- Minus
chr2R 1394108..1394141 195..228 100 <- Minus
chr2R 1395030..1395212 12..194 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:17 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..462 192..653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:10:24 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RB 1..462 192..653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:09 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..462 192..653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:30 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..462 192..653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:06:25 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..462 192..653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:50:02 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..849 12..861 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:10:24 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..849 12..860 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:09 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..849 12..860 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-31 11:07:09 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..849 12..861 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:06:25 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
TpnC4-RA 1..849 12..860 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:30 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5507684..5507866 12..194 100   Minus
2R 5503436..5503648 649..861 99 <- Minus
2R 5506238..5506258 628..648 100 <- Minus
2R 5506313..5506711 229..627 100 <- Minus
2R 5506761..5506794 195..228 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:30 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5507684..5507866 12..194 100   Minus
2R 5503436..5503648 649..861 99 <- Minus
2R 5506238..5506258 628..648 100 <- Minus
2R 5506313..5506711 229..627 100 <- Minus
2R 5506761..5506794 195..228 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:07:30 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5507684..5507866 12..194 100   Minus
2R 5503436..5503648 649..861 99 <- Minus
2R 5506238..5506258 628..648 100 <- Minus
2R 5506313..5506711 229..627 100 <- Minus
2R 5506761..5506794 195..228 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:09 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1390941..1391153 649..861 99 <- Minus
arm_2R 1393743..1393763 628..648 100 <- Minus
arm_2R 1393818..1394216 229..627 100 <- Minus
arm_2R 1394266..1394299 195..228 100 <- Minus
arm_2R 1395189..1395371 12..194 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:40:25 Download gff for FI07231.complete
Subject Subject Range Query Range Percent Splice Strand
2R 5504635..5504847 649..861 99 <- Minus
2R 5507437..5507457 628..648 100 <- Minus
2R 5507512..5507910 229..627 100 <- Minus
2R 5507960..5507993 195..228 100 <- Minus
2R 5508883..5509065 12..194 100   Minus

FI07231.pep Sequence

Translation from 191 to 652

> FI07231.pep
MADGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAV
KALIKEVDKGTTGKLDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDK
EGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFMQV
MTG*

FI07231.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13971-PA 161 GF13971-PA 9..160 2..153 768 98 Plus
Dana\GF13927-PA 173 GF13927-PA 30..170 12..153 426 60.6 Plus
Dana\GF12423-PA 155 GF12423-PA 5..154 3..153 419 53.6 Plus
Dana\GF10103-PA 155 GF10103-PA 4..154 2..153 411 52 Plus
Dana\GF14383-PA 143 GF14383-PA 1..142 11..153 388 55.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10858-PA 158 GG10858-PA 1..153 1..153 776 98.7 Plus
Dere\GG10878-PA 289 GG10878-PA 139..286 5..153 432 59.7 Plus
Dere\GG13604-PA 155 GG13604-PA 4..154 2..153 410 52 Plus
Dere\GG22682-PA 155 GG22682-PA 5..154 3..153 407 53 Plus
Dere\GG25060-PA 143 GG25060-PA 1..142 11..153 381 54.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21732-PA 154 GH21732-PA 1..153 1..153 717 88.9 Plus
Dgri\GH21731-PA 152 GH21731-PA 2..149 5..153 438 59.1 Plus
Dgri\GH21939-PA 154 GH21939-PA 4..153 3..153 414 53.6 Plus
Dgri\GH16402-PA 155 GH16402-PA 4..154 2..153 411 52 Plus
Dgri\GH21490-PA 143 GH21490-PA 1..142 11..153 377 54.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:50
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC4-PB 153 CG12408-PB 1..153 1..153 775 100 Plus
TpnC4-PA 153 CG12408-PA 1..153 1..153 775 100 Plus
TpnC41C-PB 154 CG2981-PB 4..151 5..153 436 59.7 Plus
TpnC41C-PA 154 CG2981-PA 4..151 5..153 436 59.7 Plus
TpnC73F-PC 155 CG7930-PC 5..154 3..153 411 52.3 Plus
TpnC73F-PA 155 CG7930-PA 5..154 3..153 411 52.3 Plus
TpnC47D-PB 155 CG9073-PB 5..154 3..153 408 53 Plus
TpnC47D-PA 155 CG9073-PA 5..154 3..153 408 53 Plus
TpnC25D-PC 149 CG6514-PC 3..148 7..153 394 54.4 Plus
TpnC25D-PA 149 CG6514-PA 3..148 7..153 394 54.4 Plus
TpnC25D-PB 143 CG6514-PB 3..142 13..153 383 55.3 Plus
Cam-PD 149 CG8472-PD 1..147 1..152 269 35.5 Plus
Cam-PC 149 CG8472-PC 1..147 1..152 269 35.5 Plus
Cam-PE 149 CG8472-PE 1..147 1..152 269 35.5 Plus
Cam-PB 149 CG8472-PB 1..147 1..152 269 35.5 Plus
Cam-PA 149 CG8472-PA 1..147 1..152 269 35.5 Plus
CG11638-PA 387 CG11638-PA 208..355 8..151 247 33.3 Plus
Acam-PB 148 CG17769-PB 3..146 5..152 244 30.4 Plus
Acam-PA 148 CG17769-PA 3..146 5..152 244 30.4 Plus
CG31960-PA 148 CG31960-PA 3..146 5..152 223 30.4 Plus
azot-PA 148 CG11165-PA 7..146 9..152 210 29.2 Plus
CG17493-PD 182 CG17493-PD 34..176 5..151 192 28.6 Plus
CG17493-PC 182 CG17493-PC 34..176 5..151 192 28.6 Plus
CG17493-PB 182 CG17493-PB 34..176 5..151 192 28.6 Plus
CG30378-PA 148 CG30378-PA 3..146 4..151 176 24.3 Plus
CG31802-PA 186 CG31802-PA 47..180 14..151 159 26.8 Plus
CG13526-PA 154 CG13526-PA 8..150 5..151 150 27 Plus
CG17770-PA 164 CG17770-PA 22..162 8..152 147 24 Plus
CanB2-PB 170 CG11217-PB 15..157 6..151 147 27.8 Plus
CanB2-PA 170 CG11217-PA 15..157 6..151 147 27.8 Plus
Eip63F-1-PD 166 CG15855-PD 9..165 10..151 145 22.3 Plus
CanB-PB 170 CG4209-PB 15..157 6..151 144 27.8 Plus
CanB-PA 170 CG4209-PA 15..157 6..151 144 27.8 Plus
Mlc-c-PB 153 CG3201-PB 15..153 11..153 141 26.4 Plus
Eip63F-1-PC 181 CG15855-PC 20..180 6..151 141 20.5 Plus
Eip63F-1-PA 193 CG15855-PA 32..192 6..151 141 20.5 Plus
CG5024-PB 165 CG5024-PB 24..162 9..151 139 25.9 Plus
CG5024-PA 165 CG5024-PA 24..162 9..151 139 25.9 Plus
Eip63F-1-PB 161 CG15855-PB 6..160 12..151 138 21.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18875-PA 220 GI18875-PA 6..156 2..152 712 90.7 Plus
Dmoj\GI18874-PA 186 GI18874-PA 36..183 5..153 442 59.7 Plus
Dmoj\GI19647-PA 155 GI19647-PA 5..154 3..153 413 53 Plus
Dmoj\GI12482-PA 155 GI12482-PA 4..154 2..153 410 52 Plus
Dmoj\GI24238-PA 143 GI24238-PA 1..142 11..153 386 55.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15651-PA 422 GL15651-PA 269..420 2..153 775 96.1 Plus
Dper\GL11049-PA 207 GL11049-PA 57..204 5..153 442 59.7 Plus
Dper\GL11919-PA 155 GL11919-PA 4..154 2..153 414 52 Plus
Dper\GL16748-PA 155 GL16748-PA 5..154 3..153 405 52.3 Plus
Dper\GL19565-PA 149 GL19565-PA 3..148 7..153 393 54.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:38:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\TpnCIIIb-PA 174 GA11615-PA 21..172 2..153 758 96.1 Plus
Dpse\TpnCIa-PA 155 GA23964-PA 4..154 2..153 414 52 Plus
Dpse\TpnCIb-PA 155 GA21520-PA 5..154 3..153 405 52.3 Plus
Dpse\TpnCII-PA 149 GA19654-PA 3..148 7..153 393 54.4 Plus
Dpse\TpnCIIIa-PA 70 GA27673-PA 1..67 87..153 267 76.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16508-PA 155 GM16508-PA 1..153 1..153 773 97.4 Plus
Dsec\GM25686-PA 155 GM25686-PA 4..154 2..153 410 52 Plus
Dsec\GM20459-PA 155 GM20459-PA 5..154 3..153 407 53 Plus
Dsec\GM18540-PA 143 GM18540-PA 1..142 11..153 381 54.5 Plus
Dsec\GM21351-PA 149 GM21351-PA 1..147 1..152 258 36.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10357-PA 155 GD10357-PA 1..153 1..153 778 98 Plus
Dsim\GD16679-PA 154 GD16679-PA 4..151 5..153 439 59.7 Plus
Dsim\GD14691-PA 155 GD14691-PA 4..154 2..153 410 52 Plus
Dsim\TpnC47D-PA 155 GD25928-PA 5..154 3..153 407 53 Plus
Dsim\GD23329-PA 149 GD23329-PA 3..148 7..153 391 54.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TpnCIIIb-PA 189 GJ21909-PA 1..152 2..153 706 90.1 Plus
Dvir\TpnCIIIa-PA 158 GJ21908-PA 8..155 5..153 441 59.7 Plus
Dvir\TpnCIb-PA 155 GJ15012-PA 5..154 3..153 418 53.6 Plus
Dvir\TpnCIa-PA 158 GJ12386-PA 6..157 1..153 412 51.6 Plus
Dvir\TpnCII-PA 143 GJ21496-PA 1..142 11..153 389 55.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21946-PA 557 GK21946-PA 407..555 5..153 770 96 Plus
Dwil\GK21371-PA 151 GK21371-PA 6..148 10..153 433 59.7 Plus
Dwil\GK21627-PA 155 GK21627-PA 5..154 3..153 418 53.6 Plus
Dwil\GK15267-PA 155 GK15267-PA 5..154 3..153 415 53 Plus
Dwil\GK21094-PA 150 GK21094-PA 2..149 5..153 401 55.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\TpnC4-PA 170 GE11292-PA 14..165 2..153 767 98 Plus
Dyak\GE11315-PA 152 GE11315-PA 2..149 5..153 439 59.7 Plus
Dyak\GE19899-PA 155 GE19899-PA 4..154 2..153 410 52 Plus
Dyak\TpnC47D-PA 155 GE13037-PA 5..154 3..153 408 53 Plus
Dyak\GE25333-PA 143 GE25333-PA 1..142 11..153 382 54.5 Plus

FI07231.hyp Sequence

Translation from 191 to 652

> FI07231.hyp
MADGEYDKEQLRILRNAFKAFDHDGAGSIEHADVSSILEILGQKLEPPAV
KALIKEVDKGTTGKLDFSQFCKLAARFIEVEEDVGALQNELKEAFRVYDK
EGKGYLTVATLRGILHELDDKLSNQDLDMIIEEIDADGSGTVDFDEFMQV
MTG*

FI07231.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:30:08
Subject Length Description Subject Range Query Range Score Percent Strand
TpnC4-PB 153 CG12408-PB 1..153 1..153 775 100 Plus
TpnC4-PA 153 CG12408-PA 1..153 1..153 775 100 Plus
TpnC41C-PB 154 CG2981-PB 4..151 5..153 436 59.7 Plus
TpnC41C-PA 154 CG2981-PA 4..151 5..153 436 59.7 Plus
TpnC73F-PC 155 CG7930-PC 5..154 3..153 411 52.3 Plus