Clone FI07234 Report

Search the DGRC for FI07234

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:34
Vector:pFlc-1
Associated Gene/TranscriptmRpS28-RA
Protein status:FI07234.pep: gold
Sequenced Size:702

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpS28 2008-08-15 Release 5.9 accounting
mRpS28 2008-12-18 5.12 accounting

Clone Sequence Records

FI07234.complete Sequence

702 bp assembled on 2008-07-25

GenBank Submission: BT044321.1

> FI07234.complete
GCTTTTTCTTTGGTTTTCCACTTGGTTTTGGTTTTCTTGTGGATATTTTT
GAGCAATATTAAATTAAAACCATGTCGCTCTTGCAAAAACTAAGCAGATC
TGGTGTACCGATGGCTTCATTAACCTGTCGTTCCCGAATGCCAATGGTCA
TTCGACTTATCAGCGGTAACACAGAAAAACCGGCGGAGGAATCTACTCCC
GCAGTGAATACGGAAACGGCGGAGATTGGCAGCAGCAAGGGAGGATTCGC
CCGTGCCTTCGACAAGTACACGGCACCAGCCACGCCTCCACAGCTGCCGG
AAGACAACCAGACCTTCGCCTCCCTGCTGCGCAACTCCAAATTAATTGAT
CTGGACAACGCCGAGGGCAAGGTGGTCAGTGGCAAGATCTTTCATGTGGT
GGGCGATGATCTCTACATAGACTTTGGTTGGAAGTTTCACTGCGTCTGCA
GTCGTCCAACACGCAATGCCAGCGACTATGTGCGAGGAGCCCGTGTTCGA
CTGCGCATCAAGGACTTGGAGTTGTCCACCAAGTTTCTGGGTTCGTCCAA
GGATATTACCATTCTAGAGGCAGATTGCCATTTGCTGGGTCTCCTGTCCA
CGCCCACCCGCCAGTCGACGGCCAAAACAACGCCGAAAATCGAAGATATC
CTATAAATCCTTTATTAAAACCAAGGTTTGTTAAACGAAAAAAAAAAAAA
AA

FI07234.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS28-RA 767 mRpS28-RA 10..695 2..687 3415 99.8 Plus
CG10927-RA 1174 CG10927-RA 1129..1174 687..642 230 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14501780..14502132 354..2 1720 99.2 Minus
chr2R 21145070 chr2R 14501329..14501546 687..470 1090 100 Minus
chr2R 21145070 chr2R 14501601..14501722 472..351 595 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:55:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18614661..18615013 354..2 1735 99.4 Minus
2R 25286936 2R 18614210..18614427 687..470 1090 100 Minus
2R 25286936 2R 18614482..18614603 472..351 610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18615860..18616212 354..2 1735 99.4 Minus
2R 25260384 2R 18615409..18615626 687..470 1090 100 Minus
2R 25260384 2R 18615681..18615802 472..351 610 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:55:49 has no hits.

FI07234.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:57:12 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14501329..14501543 473..687 100 <- Minus
chr2R 14501601..14501722 351..472 99 <- Minus
chr2R 14501784..14502132 1..350 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:20 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..585 72..656 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:51 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..585 72..656 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:42:09 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..585 72..656 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:03 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..585 72..656 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:30:15 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..585 72..656 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:14 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..689 1..687 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:51 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..689 1..687 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:42:09 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 3..691 1..687 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:19 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 1..689 1..687 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:30:15 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS28-RA 3..691 1..687 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:12 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18614210..18614424 473..687 100 <- Minus
2R 18614482..18614603 351..472 100 <- Minus
2R 18614665..18615013 1..350 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:12 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18614210..18614424 473..687 100 <- Minus
2R 18614482..18614603 351..472 100 <- Minus
2R 18614665..18615013 1..350 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:57:12 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18614210..18614424 473..687 100 <- Minus
2R 18614482..18614603 351..472 100 <- Minus
2R 18614665..18615013 1..350 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:42:09 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14501715..14501929 473..687 100 <- Minus
arm_2R 14501987..14502108 351..472 100 <- Minus
arm_2R 14502170..14502518 1..350 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:44 Download gff for FI07234.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18615409..18615623 473..687 100 <- Minus
2R 18615681..18615802 351..472 100 <- Minus
2R 18615864..18616212 1..350 99   Minus

FI07234.hyp Sequence

Translation from 71 to 655

> FI07234.hyp
MSLLQKLSRSGVPMASLTCRSRMPMVIRLISGNTEKPAEESTPAVNTETA
EIGSSKGGFARAFDKYTAPATPPQLPEDNQTFASLLRNSKLIDLDNAEGK
VVSGKIFHVVGDDLYIDFGWKFHCVCSRPTRNASDYVRGARVRLRIKDLE
LSTKFLGSSKDITILEADCHLLGLLSTPTRQSTAKTTPKIEDIL*

FI07234.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:30:12
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS28-PA 194 CG5497-PA 1..194 1..194 991 100 Plus

FI07234.pep Sequence

Translation from 71 to 655

> FI07234.pep
MSLLQKLSRSGVPMASLTCRSRMPMVIRLISGNTEKPAEESTPAVNTETA
EIGSSKGGFARAFDKYTAPATPPQLPEDNQTFASLLRNSKLIDLDNAEGK
VVSGKIFHVVGDDLYIDFGWKFHCVCSRPTRNASDYVRGARVRLRIKDLE
LSTKFLGSSKDITILEADCHLLGLLSTPTRQSTAKTTPKIEDIL*

FI07234.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12942-PA 192 GF12942-PA 1..192 1..194 748 73.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20964-PA 194 GG20964-PA 1..194 1..194 981 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:03:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21608-PA 192 GH21608-PA 1..180 1..189 591 67.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS28-PA 194 CG5497-PA 1..194 1..194 991 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19579-PA 194 GI19579-PA 1..194 1..194 615 62.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17445-PA 189 GL17445-PA 1..189 1..194 676 67 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18928-PA 189 GA18928-PA 1..189 1..194 676 67 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19896-PA 87 GM19896-PA 28..87 135..194 304 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25381-PA 193 GD25381-PA 1..193 1..194 954 94.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21154-PA 199 GJ21154-PA 1..197 1..194 590 62.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15786-PA 170 GK15786-PA 13..153 45..180 589 75.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\mRpS28-PA 194 GE13904-PA 1..194 1..194 957 91.8 Plus