BDGP Sequence Production Resources |
Search the DGRC for FI07238
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 72 |
Well: | 38 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG34331-RB |
Protein status: | FI07238.pep: gold |
Sequenced Size: | 622 |
Gene | Date | Evidence |
---|---|---|
CG34331 | 2008-08-15 | Release 5.9 accounting |
CG34331 | 2008-12-18 | 5.12 accounting |
622 bp assembled on 2008-07-29
GenBank Submission: BT050508.1
> FI07238.complete CCAGAGTTGCTTCTTGCTTGCCACCGAGATGAGCGCAATAAAGCCCGCCC TGCTGCTCTGCCTGATCCTCACCATCGGTCTGTTCCTTGGTCAAGGTCGG GCGAATCCCGTGGAGACGAATGTTCCCGATATTCCCGCACCCGATGCCAA CGAACTGGGCATCGATTTCGGAGAGGAGGAAGATGCCACCGACAAGCCAC TGGGCATATTCACGATCAAGGTGCGCCACATTCAGCCGGACCCCGCCCAC TGCGCCCAGCTCTCGCCACATCACCCACACCACCCCCAGTGCCACAGCTA CTGCAAACGCCAAGGTCACTGGGTGGGCCAGTGCAAGAAGGACATCTGTC AGTGCTTTTCCTAGGTCTACTTCGACTGTAAGCCAAAACAGCGTTTTTTT TTTTCTTTTGTTGAGTGCAGCACAACTATATGACGAAATATGTGCAAATA TGTTTATCTACCAACTAGTATATATATTAAAACTGGCAATGAACAATGAA AGCGAATCAAAATTGCTCAAATCATACACATAATATGTAGTCTTTGACCT TCTAACATGCACTGAATAGAAAAAGCAGAACCTTAATAAATCTTCAAGTT AAATCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34331-RB | 605 | CG34331-RB | 4..603 | 5..604 | 3000 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 20011034..20011633 | 5..604 | 2955 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 20122460..20123063 | 5..608 | 3005 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 20130558..20131161 | 5..608 | 3005 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ZAM | 8435 | ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). | 2445..2521 | 425..502 | 117 | 64.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 20011029..20011635 | 1..606 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RA | 50..414 | 1..364 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RB | 1..336 | 29..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RB | 1..336 | 29..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RA | 50..414 | 1..364 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RB | 1..336 | 29..364 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RA | 50..656 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RB | 1..605 | 3..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RB | 3..609 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RA | 50..656 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34331-RB | 3..609 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20122455..20123061 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20122455..20123061 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20122455..20123061 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 20016488..20017094 | 1..606 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 20130553..20131159 | 1..606 | 99 | Plus |
Translation from 1 to 363
> FI07238.pep QSCFLLATEMSAIKPALLLCLILTIGLFLGQGRANPVETNVPDIPAPDAN ELGIDFGEEEDATDKPLGIFTIKVRHIQPDPAHCAQLSPHHPHHPQCHSY CKRQGHWVGQCKKDICQCFS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20233-PA | 775 | GF20233-PA | 6..93 | 17..108 | 195 | 47.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG19270-PA | 116 | GG19270-PA | 1..116 | 10..120 | 379 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24629-PA | 133 | GH24629-PA | 69..133 | 56..120 | 177 | 49.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34331-PB | 111 | CG34331-PB | 1..111 | 10..120 | 624 | 100 | Plus |
CG34331-PC | 134 | CG34331-PC | 1..69 | 10..78 | 332 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15817-PA | 118 | GI15817-PA | 22..118 | 30..120 | 181 | 41.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12923-PA | 145 | GL12923-PA | 53..119 | 48..114 | 210 | 55.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22835-PA | 125 | GA22835-PA | 51..125 | 46..120 | 225 | 53.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23005-PA | 110 | GM23005-PA | 1..110 | 10..120 | 514 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17475-PA | 111 | GD17475-PA | 1..111 | 10..120 | 479 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18669-PA | 128 | GJ18669-PA | 5..128 | 15..120 | 202 | 36.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK16338-PA | 264 | GK16338-PA | 69..120 | 57..108 | 150 | 50 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15888-PA | 110 | GE15888-PA | 1..110 | 10..120 | 447 | 88.3 | Plus |
Translation from 119 to 532
> FI07238.hyp MFPIFPHPMPTNWASISERRKMPPTSHWAYSRSRCATFSRTPPTAPSSRH ITHTTPSATATANAKVTGWASARRTSVSAFPRSTSTVSQNSVFFFLLLSA AQLYDEICANMFIYQLVYILKLAMNNESESKLLKSYT*