Clone FI07238 Report

Search the DGRC for FI07238

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:38
Vector:pFlc-1
Associated Gene/TranscriptCG34331-RB
Protein status:FI07238.pep: gold
Sequenced Size:622

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34331 2008-08-15 Release 5.9 accounting
CG34331 2008-12-18 5.12 accounting

Clone Sequence Records

FI07238.complete Sequence

622 bp assembled on 2008-07-29

GenBank Submission: BT050508.1

> FI07238.complete
CCAGAGTTGCTTCTTGCTTGCCACCGAGATGAGCGCAATAAAGCCCGCCC
TGCTGCTCTGCCTGATCCTCACCATCGGTCTGTTCCTTGGTCAAGGTCGG
GCGAATCCCGTGGAGACGAATGTTCCCGATATTCCCGCACCCGATGCCAA
CGAACTGGGCATCGATTTCGGAGAGGAGGAAGATGCCACCGACAAGCCAC
TGGGCATATTCACGATCAAGGTGCGCCACATTCAGCCGGACCCCGCCCAC
TGCGCCCAGCTCTCGCCACATCACCCACACCACCCCCAGTGCCACAGCTA
CTGCAAACGCCAAGGTCACTGGGTGGGCCAGTGCAAGAAGGACATCTGTC
AGTGCTTTTCCTAGGTCTACTTCGACTGTAAGCCAAAACAGCGTTTTTTT
TTTTCTTTTGTTGAGTGCAGCACAACTATATGACGAAATATGTGCAAATA
TGTTTATCTACCAACTAGTATATATATTAAAACTGGCAATGAACAATGAA
AGCGAATCAAAATTGCTCAAATCATACACATAATATGTAGTCTTTGACCT
TCTAACATGCACTGAATAGAAAAAGCAGAACCTTAATAAATCTTCAAGTT
AAATCCAAAAAAAAAAAAAAAA

FI07238.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-RB 605 CG34331-RB 4..603 5..604 3000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20011034..20011633 5..604 2955 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20122460..20123063 5..608 3005 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20130558..20131161 5..608 3005 99.8 Plus
Blast to na_te.dros performed 2019-03-16 10:51:43
Subject Length Description Subject Range Query Range Score Percent Strand
ZAM 8435 ZAM DMZAM 8435bp Derived from AJ000387 (e1237231) ((Rel. 54, Last updated, Version 1). 2445..2521 425..502 117 64.6 Plus

FI07238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:52:19 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20011029..20011635 1..606 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:21 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..414 1..364 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:33 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 29..364 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:30 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 29..364 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:55 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..414 1..364 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:18:52 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..336 29..364 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:34 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..656 1..606 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:33 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 1..605 3..606 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:30 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 3..609 1..606 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:34 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RA 50..656 1..606 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:18:52 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
CG34331-RB 3..609 1..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:19 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122455..20123061 1..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:19 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122455..20123061 1..606 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:19 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
X 20122455..20123061 1..606 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:30 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20016488..20017094 1..606 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:06 Download gff for FI07238.complete
Subject Subject Range Query Range Percent Splice Strand
X 20130553..20131159 1..606 99   Plus

FI07238.pep Sequence

Translation from 1 to 363

> FI07238.pep
QSCFLLATEMSAIKPALLLCLILTIGLFLGQGRANPVETNVPDIPAPDAN
ELGIDFGEEEDATDKPLGIFTIKVRHIQPDPAHCAQLSPHHPHHPQCHSY
CKRQGHWVGQCKKDICQCFS*

FI07238.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20233-PA 775 GF20233-PA 6..93 17..108 195 47.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19270-PA 116 GG19270-PA 1..116 10..120 379 82.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24629-PA 133 GH24629-PA 69..133 56..120 177 49.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG34331-PB 111 CG34331-PB 1..111 10..120 624 100 Plus
CG34331-PC 134 CG34331-PC 1..69 10..78 332 95.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15817-PA 118 GI15817-PA 22..118 30..120 181 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12923-PA 145 GL12923-PA 53..119 48..114 210 55.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22835-PA 125 GA22835-PA 51..125 46..120 225 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23005-PA 110 GM23005-PA 1..110 10..120 514 88.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:33:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17475-PA 111 GD17475-PA 1..111 10..120 479 91.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18669-PA 128 GJ18669-PA 5..128 15..120 202 36.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16338-PA 264 GK16338-PA 69..120 57..108 150 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15888-PA 110 GE15888-PA 1..110 10..120 447 88.3 Plus

FI07238.hyp Sequence

Translation from 119 to 532

> FI07238.hyp
MFPIFPHPMPTNWASISERRKMPPTSHWAYSRSRCATFSRTPPTAPSSRH
ITHTTPSATATANAKVTGWASARRTSVSAFPRSTSTVSQNSVFFFLLLSA
AQLYDEICANMFIYQLVYILKLAMNNESESKLLKSYT*
Sequence FI07238.hyp has no blast hits.