Clone FI07257 Report

Search the DGRC for FI07257

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:72
Well:57
Vector:pFlc-1
Associated Gene/TranscriptmRpL2-RA
Protein status:FI07257.pep: gold
Sequenced Size:1030

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL2 2008-08-15 Release 5.9 accounting
mRpL2 2008-12-18 5.12 accounting

Clone Sequence Records

FI07257.complete Sequence

1030 bp assembled on 2008-07-15

GenBank Submission: BT044326.1

> FI07257.complete
AGTTTCGATTTTGTAACAGTTTGCATATATTTTCGTTCTATTTAATTTTT
CAAATAAAACTATCGAAAATGCAAAGTGTAACACGTTTGCTGAGCACAAC
GCTGACTATACAAACGCCGTTTCGCACGGCGCCGGCGTTTCTGCAGCAAT
TGCGCGGCAAAACCAAAGTGGTGGAGAAACCAAAACCTGGTGCCGGACAG
CAATTCCGACGAACCGTGCACTTTCCGGAGAAGTACACCGTTGAGCCGCT
GAAGATCACCCATTTGGCTGGTCGGGATCCCGTCTCCGGTCGCTTGGTGG
CCAAGGGCATTGGCGGAGGCATCAAACAGCAGTATCGCTGGGTTAAATGG
GTGCGGGATGGTCCCACGGAGGGCGCCCAGGAGGAACTGGTACTCGAGGT
GCTACGCGATGGCTGTCGCACCGCCAAAGTGGCCCTGGTTGCCGTCGGCG
ATGAGCTGAAGTACATCCTGGCCACCGAGAACATGAAGGCTGGCGATATC
CTCAAGACCTCGCGCTTTATTCCTAGGATTCCGGTGCGTCCCAACGAAGG
CGATGCCTATCCATTGGGCGCCTTGCCCGTGGGCACACGCATTCACTGTC
TGGAGAAGAACCCCGGCCAGATGTGCCACCTGATCCATGCCGCCGGCACC
TTCGGCACCATTCTGCGCAAGTTCGACGAAAAGGTGGTGGTGCAGCTGCC
CTCGAAGCGGGAGTTCGCCTTCCAGCGCACCTGCATGGCGACGGTTGGTC
GCCTGTCCAACCCGGAACACAACAAGGAGCATGTGGGCAGTGCCCAGCGG
ATGCGGGAGATGGGCAATCGACCACGTTCCGGTCTGTGGAAGCGCAAGGA
AGGCAAACACGGACGCAAGATACGCCGATTGCCGCCCATGACCACCATAT
CGCCACCGGCTCCGCCCAAGGAGGAGGCCATCAAGTTGACGCTGCCCCTG
TGAGGTTTTTCCTTTAATTTCTATGTGTCACACAATATATAACTAGAACT
AGAGATACAGAGCGAAAAAAAAAAAAAAAA

FI07257.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL2-RA 1102 mRpL2-RA 57..1067 3..1013 5055 100 Plus
Ufd1-like-RA 1332 Ufd1-like-RA 1255..1332 1013..936 390 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11111752..11112283 3..534 2660 100 Plus
chr3L 24539361 chr3L 11112440..11112919 534..1013 2370 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11120875..11121406 3..534 2660 100 Plus
3L 28110227 3L 11121562..11122041 534..1013 2400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11113975..11114506 3..534 2660 100 Plus
3L 28103327 3L 11114662..11115141 534..1013 2400 100 Plus
Blast to na_te.dros performed 2019-03-16 01:44:19
Subject Length Description Subject Range Query Range Score Percent Strand
G4 3856 G4 G4_DM 3856bp 2600..2661 70..6 111 66.2 Minus

FI07257.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:45:44 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11111751..11112283 1..534 99 -> Plus
chr3L 11112441..11112919 535..1014 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:32 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 1..885 69..953 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:22 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 1..885 69..953 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:49 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 1..885 69..953 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:52:43 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 1..885 69..953 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:40:32 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 1..885 69..953 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:28:19 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 16..1027 1..1013 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:21 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 16..1027 1..1013 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:49 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 28..1039 1..1013 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:52:43 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 16..1026 1..1012 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:40:32 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL2-RA 28..1039 1..1013 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:45:44 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11120874..11121406 1..534 99 -> Plus
3L 11121563..11122041 535..1014 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:45:44 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11120874..11121406 1..534 99 -> Plus
3L 11121563..11122041 535..1014 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:45:44 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11120874..11121406 1..534 99 -> Plus
3L 11121563..11122041 535..1014 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:49 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11113974..11114506 1..534 99 -> Plus
arm_3L 11114663..11115141 535..1014 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:33:59 Download gff for FI07257.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11113974..11114506 1..534 99 -> Plus
3L 11114663..11115141 535..1014 99   Plus

FI07257.pep Sequence

Translation from 2 to 952

> FI07257.pep
FRFCNSLHIFSFYLIFQIKLSKMQSVTRLLSTTLTIQTPFRTAPAFLQQL
RGKTKVVEKPKPGAGQQFRRTVHFPEKYTVEPLKITHLAGRDPVSGRLVA
KGIGGGIKQQYRWVKWVRDGPTEGAQEELVLEVLRDGCRTAKVALVAVGD
ELKYILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCL
EKNPGQMCHLIHAAGTFGTILRKFDEKVVVQLPSKREFAFQRTCMATVGR
LSNPEHNKEHVGSAQRMREMGNRPRSGLWKRKEGKHGRKIRRLPPMTTIS
PPAPPKEEAIKLTLPL*

FI07257.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25244-PA 297 GF25244-PA 1..297 23..316 1411 90.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15481-PA 296 GG15481-PA 1..296 23..316 1462 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:59:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16930-PA 296 GH16930-PA 1..296 23..316 1302 84.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL2-PA 294 CG7636-PA 1..294 23..316 1541 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13684-PA 294 GI13684-PA 1..278 23..300 1273 87.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:59:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22842-PA 159 GL22842-PA 1..145 23..164 590 81.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20496-PA 297 GA20496-PA 1..297 23..316 1363 87.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25252-PA 296 GM25252-PA 1..296 23..316 1508 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14286-PA 296 GD14286-PA 1..296 23..316 1520 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14025-PA 296 GJ14025-PA 1..296 23..316 1329 86.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20336-PA 295 GK20336-PA 1..295 23..316 1332 85.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21791-PA 295 GE21791-PA 1..295 23..316 1430 95.9 Plus

FI07257.hyp Sequence

Translation from 2 to 952

> FI07257.hyp
FRFCNSLHIFSFYLIFQIKLSKMQSVTRLLSTTLTIQTPFRTAPAFLQQL
RGKTKVVEKPKPGAGQQFRRTVHFPEKYTVEPLKITHLAGRDPVSGRLVA
KGIGGGIKQQYRWVKWVRDGPTEGAQEELVLEVLRDGCRTAKVALVAVGD
ELKYILATENMKAGDILKTSRFIPRIPVRPNEGDAYPLGALPVGTRIHCL
EKNPGQMCHLIHAAGTFGTILRKFDEKVVVQLPSKREFAFQRTCMATVGR
LSNPEHNKEHVGSAQRMREMGNRPRSGLWKRKEGKHGRKIRRLPPMTTIS
PPAPPKEEAIKLTLPL*

FI07257.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL2-PA 294 CG7636-PA 1..294 23..316 1541 100 Plus