Clone FI07302 Report

Search the DGRC for FI07302

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:73
Well:2
Vector:pFlc-1
Associated Gene/TranscriptCG8320-RA
Protein status:FI07302.pep: gold
Sequenced Size:992

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8320 2008-08-15 Release 5.9 accounting
CG8320 2008-12-18 5.12 accounting

Clone Sequence Records

FI07302.complete Sequence

992 bp assembled on 2008-07-29

GenBank Submission: BT044328.1

> FI07302.complete
AATGAACCAGCACCGTGGGCGTAGATTGAATATATTTAATGCGCACGTTT
CACAGCACTCGTTTCAACACCGTTTTGTTCAGTTGAAGACGTCGCCACGT
AAATAGTGGTCCGATTTTAGATTTTGAAATAGCTGACACACAACTTGCAA
TCCCACCATGGCTCCCCAGCAAAAGGGTAAACAAGGCACGAAGGGCGCCA
AGCAAATCGTGGAGGAAAACAAGACTACACTGACTTTCTACCGGAACATG
GCCATTGGATGTGCTGCACCCGCTCTGCTCCTCAGTTTCCTGGTCTTCGA
AGTCACCAAAACCTCAGTGTTTATGCACATTCTTTCGTTGCTGATCCTGG
GGAGCTCCTACCAGTTTATGGCGTTCATGTCGCAGGCCAAATACTCTGAG
AGCGGTGCTCTTTTGGACTCCGGCAACGACTTAAATATGGAAGGCGGCAT
CGCGGAAAACGTTAAGGATTTGATCATCCTTACTTCCGGCACCCTGCTGC
TGGCCCTCATCTCAAACTACTTCTGGTTGGTGCTGCTTTTGGCGCCCATA
CGAGCTGGATGGATGCTCTGGGGCTCCGTCATCCAGCCGTGGCTGTCGCA
ACGCAACGCCCAGGACGATAATCCCCAGGTGGACGAGAAAAAGCAAAAAA
AGATGGATCGCAGAATGCGTCGCATGAGATAGAAGCCACTTTCCGAGTTG
ACCTGGTGGTTAAGGGGTTCCTGGTTTTAATGAGATTCTACGCTTAGTTG
TGTGTGCGTTTCCAATTTGTTAATTGTTCAGCAAATTAAACTGCTCGAGA
CAAAGACAATTCATTGTTTTAGTTAGTCAAAGCATTTGTGCGATTTAATT
GCGGTGAATTTTTAAAGACGCAAACTTTGCGAGGGAAATTGCATTTCCTC
AAGGCTGCCTCCCATTTTTTGTGCATTGTAAATATTCGTGTAATTGTTTA
TAAATAAATGTGCTTCAGTGCAGCTGGAAAAAAAAAAAAAAA

FI07302.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG8320-RA 1019 CG8320-RA 34..1014 1..979 4820 99.5 Plus
ATPCL.b 5194 ATPCL.b 3911..4433 979..457 2600 99.8 Minus
ATPCL.a 5490 ATPCL.a 4207..4729 979..457 2600 99.8 Minus
ATPCL.b 5194 ATPCL.b 4687..4842 319..164 780 100 Minus
ATPCL.a 5490 ATPCL.a 4983..5138 319..164 780 100 Minus
ATPCL.b 5194 ATPCL.b 4491..4628 456..319 690 100 Minus
ATPCL.a 5490 ATPCL.a 4787..4924 456..319 690 100 Minus
ATPCL.b 5194 ATPCL.b 4908..5036 163..37 590 98.4 Minus
ATPCL.a 5490 ATPCL.a 5204..5332 163..37 590 98.4 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11880456..11880973 457..974 2590 100 Plus
chr2R 21145070 chr2R 11880047..11880202 164..319 780 100 Plus
chr2R 21145070 chr2R 11880261..11880398 319..456 690 100 Plus
chr2R 21145070 chr2R 11879853..11879981 37..163 580 98.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15993187..15993709 457..979 2600 99.8 Plus
2R 25286936 2R 15992778..15992933 164..319 780 100 Plus
2R 25286936 2R 15992992..15993129 319..456 690 100 Plus
2R 25286936 2R 15992584..15992712 37..163 580 98.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15994386..15994908 457..979 2600 99.8 Plus
2R 25260384 2R 15993977..15994132 164..319 780 100 Plus
2R 25260384 2R 15994191..15994328 319..456 690 100 Plus
2R 25260384 2R 15993783..15993911 37..163 590 98.4 Plus
2R 25260384 2R 15993609..15993644 1..36 165 97.2 Plus
Blast to na_te.dros performed on 2019-03-16 00:41:05 has no hits.

FI07302.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:11 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11880262..11880398 320..456 100 -> Plus
chr2R 11880047..11880202 164..319 100 -> Plus
chr2R 11879853..11879981 37..163 98 -> Plus
chr2R 11879679..11879714 1..36 97 -> Plus
chr2R 11880456..11880976 457..977 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:35 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..525 158..682 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:29 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..525 158..682 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:08 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..525 158..682 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:54 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..525 158..682 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:09:08 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..525 158..682 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:29 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..979 1..977 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:29 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..979 1..977 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:08 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 3..981 1..977 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:43 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 1..979 1..977 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:09:08 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
CG8320-RA 3..981 1..977 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:11 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992410..15992445 1..36 97 -> Plus
2R 15992584..15992712 37..163 98 -> Plus
2R 15992778..15992933 164..319 100 -> Plus
2R 15992993..15993129 320..456 100 -> Plus
2R 15993187..15993707 457..977 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:11 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992410..15992445 1..36 97 -> Plus
2R 15992584..15992712 37..163 98 -> Plus
2R 15992778..15992933 164..319 100 -> Plus
2R 15992993..15993129 320..456 100 -> Plus
2R 15993187..15993707 457..977 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:11 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15992410..15992445 1..36 97 -> Plus
2R 15992584..15992712 37..163 98 -> Plus
2R 15992778..15992933 164..319 100 -> Plus
2R 15992993..15993129 320..456 100 -> Plus
2R 15993187..15993707 457..977 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:08 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11879915..11879950 1..36 97 -> Plus
arm_2R 11880089..11880217 37..163 98 -> Plus
arm_2R 11880283..11880438 164..319 100 -> Plus
arm_2R 11880498..11880634 320..456 100 -> Plus
arm_2R 11880692..11881212 457..977 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:02 Download gff for FI07302.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15994386..15994906 457..977 99   Plus
2R 15993609..15993644 1..36 97 -> Plus
2R 15993783..15993911 37..163 98 -> Plus
2R 15993977..15994132 164..319 100 -> Plus
2R 15994192..15994328 320..456 100 -> Plus

FI07302.hyp Sequence

Translation from 157 to 681

> FI07302.hyp
MAPQQKGKQGTKGAKQIVEENKTTLTFYRNMAIGCAAPALLLSFLVFEVT
KTSVFMHILSLLILGSSYQFMAFMSQAKYSESGALLDSGNDLNMEGGIAE
NVKDLIILTSGTLLLALISNYFWLVLLLAPIRAGWMLWGSVIQPWLSQRN
AQDDNPQVDEKKQKKMDRRMRRMR*

FI07302.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG8320-PA 174 CG8320-PA 1..174 1..174 884 100 Plus

FI07302.pep Sequence

Translation from 157 to 681

> FI07302.pep
MAPQQKGKQGTKGAKQIVEENKTTLTFYRNMAIGCAAPALLLSFLVFEVT
KTSVFMHILSLLILGSSYQFMAFMSQAKYSESGALLDSGNDLNMEGGIAE
NVKDLIILTSGTLLLALISNYFWLVLLLAPIRAGWMLWGSVIQPWLSQRN
AQDDNPQVDEKKQKKMDRRMRRMR*

FI07302.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11552-PA 174 GF11552-PA 1..174 1..174 812 85.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20556-PA 174 GG20556-PA 1..174 1..174 877 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22057-PA 143 GH22057-PA 1..143 31..174 583 81.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG8320-PA 174 CG8320-PA 1..174 1..174 884 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19142-PA 174 GI19142-PA 1..174 1..174 820 87.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19886-PA 173 GL19886-PA 1..173 1..174 800 85.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20984-PA 173 GA20984-PA 1..173 1..174 800 85.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21649-PA 174 GM21649-PA 1..174 1..174 917 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11148-PA 174 GD11148-PA 1..174 1..174 917 98.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22275-PA 173 GJ22275-PA 1..173 1..174 787 83.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10746-PA 173 GK10746-PA 1..173 1..174 773 80.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11741-PA 174 GE11741-PA 1..174 1..174 875 93.7 Plus