Clone FI07333 Report

Search the DGRC for FI07333

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:73
Well:33
Vector:pFlc-1
Associated Gene/TranscriptCG10031-RA
Protein status:FI07333.pep: gold
Sequenced Size:593

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10031 2008-08-15 Release 5.9 accounting
CG10031 2008-12-18 5.12 accounting

Clone Sequence Records

FI07333.complete Sequence

593 bp assembled on 2008-08-14

GenBank Submission: BT044329.1

> FI07333.complete
CAGTTCACAGTCGTTGCTTTTAACGTTCAGTTATCAGGCTGCAAACACAA
AATGCTTCTGCGGATGACCCAGTTTCTCTGCCTTGCGGCACTCGTTTTGC
TAAGTCTTATGCAACTTACGCAGGCAGTAGCCACTCCCAATAATAATAAT
AATAATAATAACAATATTAAACCGAAGGCTGTGGTTCAGGTGCAACCTGG
AAATCCATCGGGAAACAAGCCTGCAGTTGCCACAACTACAATCAAACCAC
AGAGACTGGTACCAGATCCCAAATGCCTGCAGCCCTTGGACGTTGGTCCA
TGCCGCATGAGCCTAGAAAGGTTCTACTACAACAAGGATTCAAAAGCTTG
CGAGACCTTCAAGTACGGAGGATGTCGAGGCAATGACAATCGTTGGGGAT
TCCGACAAACTTGTGAGGAGGCTTGTATTCCCAAAAAGTGATCCATTGAT
GGCGGTCACAAAATACGAGATTGTTTTTAAATTGTAAATGCTAGATGAAA
TTATTTGTTGATGTATTTTTAAAATAATTACTTGAAATGGGTTTTTGCTA
ATGCGAAATATATACGTTTAATAATTAAAAAAAAAAAAAAAAA

FI07333.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG10031-RA 742 CG10031-RA 122..699 1..578 2875 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3697961..3698272 576..264 1515 99.7 Minus
chr2L 23010047 chr2L 3698336..3698600 265..1 1295 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3698449..3698763 578..264 1575 100 Minus
2L 23513712 2L 3698827..3699091 265..1 1310 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3698449..3698763 578..264 1575 100 Minus
2L 23513712 2L 3698827..3699091 265..1 1310 99.6 Minus
Blast to na_te.dros performed 2019-03-16 04:38:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 53..141 547..469 116 65.2 Minus

FI07333.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:23 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3697961..3698270 266..576 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:38 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:09:01 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:48 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:04 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:47:15 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..390 52..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:36:13 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..576 1..576 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:09:01 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..576 1..576 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:48 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 2..577 1..576 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 16:06:18 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 1..472 1..472 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:47:15 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
CG10031-RA 2..577 1..576 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:23 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3698451..3698761 266..576 100 <- Minus
2L 3698827..3699091 1..265 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:23 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3698451..3698761 266..576 100 <- Minus
2L 3698827..3699091 1..265 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:23 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3698451..3698761 266..576 100 <- Minus
2L 3698827..3699091 1..265 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:48 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3698451..3698761 266..576 100 <- Minus
arm_2L 3698827..3699091 1..265 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:42 Download gff for FI07333.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3698827..3699091 1..265 99   Minus
2L 3698451..3698761 266..576 100 <- Minus

FI07333.hyp Sequence

Translation from 0 to 440

> FI07333.hyp
QFTVVAFNVQLSGCKHKMLLRMTQFLCLAALVLLSLMQLTQAVATPNNNN
NNNNNIKPKAVVQVQPGNPSGNKPAVATTTIKPQRLVPDPKCLQPLDVGP
CRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACIPKK*

FI07333.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG10031-PA 129 CG10031-PA 1..129 18..146 699 100 Plus
CG3604-PB 132 CG3604-PB 36..108 73..145 155 39.7 Plus
CG3604-PA 132 CG3604-PA 36..108 73..145 155 39.7 Plus

FI07333.pep Sequence

Translation from 0 to 440

> FI07333.pep
QFTVVAFNVQLSGCKHKMLLRMTQFLCLAALVLLSLMQLTQAVATPNNNN
NNNNNIKPKAVVQVQPGNPSGNKPAVATTTIKPQRLVPDPKCLQPLDVGP
CRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQTCEEACIPKK*

FI07333.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:03:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14652-PA 126 GF14652-PA 1..123 18..146 444 72.9 Plus
Dana\GF14653-PA 137 GF14653-PA 38..108 69..143 155 42.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24407-PA 128 GG24407-PA 1..128 18..146 585 92.2 Plus
Dere\GG24408-PA 132 GG24408-PA 34..109 71..146 150 38.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:04:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13177-PA 120 GH13177-PA 1..116 22..143 299 48.4 Plus
Dgri\GH18720-PA 3177 GH18720-PA 1983..2035 90..142 143 41.5 Plus
Dgri\GH13178-PA 135 GH13178-PA 49..106 87..145 140 42.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG10031-PA 129 CG10031-PA 1..129 18..146 699 100 Plus
CG3604-PB 132 CG3604-PB 36..108 73..145 155 39.7 Plus
CG3604-PA 132 CG3604-PA 36..108 73..145 155 39.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17755-PA 121 GI17755-PA 2..121 17..146 382 59.6 Plus
Dmoj\GI17756-PA 142 GI17756-PA 31..108 61..145 148 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19457-PA 118 GL19457-PA 1..118 20..141 370 63.2 Plus
Dper\GL19458-PA 129 GL19458-PA 35..101 80..145 143 38.8 Plus
Dper\GL23094-PA 2914 GL23094-PA 2264..2318 92..146 143 43.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:04:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25967-PA 123 GA25967-PA 1..123 20..146 400 64.6 Plus
Dpse\GA17552-PA 129 GA17552-PA 9..101 31..145 143 32.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18124-PA 130 GM18124-PA 1..130 18..146 589 93.9 Plus
Dsec\GM18125-PA 130 GM18125-PA 32..107 71..146 145 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:04:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22732-PA 131 GD22732-PA 1..131 18..146 589 93.9 Plus
Dsim\GD22733-PA 130 GD22733-PA 32..107 71..146 146 36.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17583-PA 126 GJ17583-PA 2..126 17..146 345 54.8 Plus
Dvir\GJ17584-PA 144 GJ17584-PA 50..108 87..146 146 45 Plus
Dvir\GJ14166-PA 3023 GJ14166-PA 1854..1906 90..142 142 43.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15467-PA 111 GK15467-PA 3..111 23..146 320 56 Plus
Dwil\GK15466-PA 103 GK15466-PA 9..103 23..146 257 47.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14809-PA 127 GE14809-PA 1..127 18..146 572 89.1 Plus
Dyak\GE14811-PA 130 GE14811-PA 34..109 71..146 152 38.2 Plus