Clone FI07350 Report

Search the DGRC for FI07350

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:73
Well:50
Vector:pFlc-1
Associated Gene/TranscriptCG1648-RB
Protein status:FI07350.pep: gold
Sequenced Size:901

Clone Sequence Records

FI07350.complete Sequence

901 bp assembled on 2009-10-06

GenBank Submission: BT099962.1

> FI07350.complete
GAGTTAGCATTCAGAGGGCCAGTCAGCATGTTTCCTAGTCGCCAAAACCA
AACTTCCTTGAAGAACTTCGGTGACAAGACCGCCAACCTCTTCAGCAAGA
AGAAGGATGAGGCCGAGAAGCTGGCCAACGAGAAGGCTGCCGAGGCCCAG
AAGCTAGCCGAGGAGCAGGCCAAGAAGGTGGGCCAGTCCGTACAGCAGAC
CAAGGGCGAGGCCGAGCAGTTGGCCGCCAGCACGGCCAAGGAAGCCGCTG
CTCTAGCCACCGCGGAGGCTCAGAAGGCTGGACAGGCGATTGACCAGGGT
GTGAACCGTGCCGCCGGAGCCGTCAACCAAGGCAAGCAGGCGGTGGACAA
CACGGTGGCCCAGGCGGCGGCCGTGGCCCAGAACTCCAAGCAGGTGGCGG
CCAATGTGGCGGAGGCCTCCCAGCGAGCGGCCGCCAATGCGGTGGACCAG
ACCAAGAAGGCGGCCAACGACGCCATCAACAAGAGCGTGAAGGCCGCCGA
GAACGTGGCGGACCAGAAGCTGAAGCAGGCGGAGGGCGCCATCGATGGGG
CACTGAAGCAGACCAGTCAAACGGTGGACCAGAAGCTGCAGGAGGCCAAC
CAGTATGTCGACCAGAAGCGCCAGTCCGTCGAGAAGACCGTCCAGGATGC
GGCAGGACAGGCCCAGGAGTCTGCCGGACAGCAGGCCAACGCCCTGTTGG
GCAAGCTGCATCTGGGTCAGAAGTAGAGGCGTCTCCCTTCGCGGTGCCAC
CTAAAATATCTTGATGTGAAAATGCTTTAGATACAAAAACAAAAAAAATA
GAAAGGAATTTGCTTCAATGTAACGAGTGCCAGTAATGTGATTGCTAAAT
CCTCAATTGAATATACACAATATATATATATATATAAAAAAAAAAAAAAA
A

FI07350.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG1648-RB 1092 CG1648-RB 125..1009 2..886 4395 99.7 Plus
CG1648.d 1306 CG1648.d 125..1009 2..886 4395 99.7 Plus
CG1648.c 1488 CG1648.c 311..1144 53..886 4140 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5698793..5699443 885..235 3195 99.4 Minus
chr2R 21145070 chr2R 5699948..5700130 235..53 915 100 Minus
chr2R 21145070 chr2R 5700190..5700240 52..2 255 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:41:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 9811318..9811969 886..235 3230 99.7 Minus
2R 25286936 2R 9812482..9812664 235..53 915 100 Minus
2R 25286936 2R 9812724..9812774 52..2 255 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 9812517..9813168 886..235 3230 99.6 Minus
2R 25260384 2R 9813681..9813863 235..53 915 100 Minus
2R 25260384 2R 9813923..9813973 52..2 255 100 Minus
Blast to na_te.dros performed 2019-03-15 18:41:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\Osvaldo 9045 Dbuz\Osvaldo DBU133521 9045bp Derived from AJ133521 (Rel. 60, Last updated, Version 2). 2933..2997 496..560 109 63.1 Plus

FI07350.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:42:24 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5698793..5699442 236..885 99 <- Minus
chr2R 5699948..5700130 53..235 100 <- Minus
chr2R 5700190..5700240 1..52 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:49 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..699 28..726 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:41:19 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..699 28..726 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:28:06 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..699 28..726 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:57:40 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..699 28..726 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-06 14:14:54 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..818 2..819 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:41:19 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..818 2..819 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:28:06 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..884 2..885 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:57:40 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
CG1648-RB 1..884 2..885 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:42:24 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9812482..9812664 53..235 100 <- Minus
2R 9812724..9812774 1..52 98   Minus
2R 9811319..9811968 236..885 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:42:24 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9812482..9812664 53..235 100 <- Minus
2R 9812724..9812774 1..52 98   Minus
2R 9811319..9811968 236..885 99 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:42:24 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9812482..9812664 53..235 100 <- Minus
2R 9812724..9812774 1..52 98   Minus
2R 9811319..9811968 236..885 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:28:06 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5699987..5700169 53..235 100 <- Minus
arm_2R 5700229..5700279 1..52 98   Minus
arm_2R 5698824..5699473 236..885 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:22:57 Download gff for FI07350.complete
Subject Subject Range Query Range Percent Splice Strand
2R 9812518..9813167 236..885 99 <- Minus
2R 9813681..9813863 53..235 100 <- Minus
2R 9813923..9813973 1..52 98   Minus

FI07350.pep Sequence

Translation from 0 to 725

> FI07350.pep
ELAFRGPVSMFPSRQNQTSLKNFGDKTANLFSKKKDEAEKLANEKAAEAQ
KLAEEQAKKVGQSVQQTKGEAEQLAASTAKEAAALATAEAQKAGQAIDQG
VNRAAGAVNQGKQAVDNTVAQAAAVAQNSKQVAANVAEASQRAAANAVDQ
TKKAANDAINKSVKAAENVADQKLKQAEGAIDGALKQTSQTVDQKLQEAN
QYVDQKRQSVEKTVQDAAGQAQESAGQQANALLGKLHLGQK*

FI07350.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:26:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11480-PA 232 GF11480-PA 1..232 10..241 995 94.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25263-PA 230 GG25263-PA 1..230 10..241 1043 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22847-PA 233 GH22847-PA 1..233 10..241 842 80.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG1648-PB 232 CG1648-PB 1..232 10..241 1113 100 Plus
CG1648-PC 230 CG1648-PC 8..230 19..241 1065 100 Plus
CG1648-PA 230 CG1648-PA 8..230 19..241 1065 100 Plus
CG45076-PH 619 CG45076-PH 311..545 14..229 158 25.1 Plus
CG45076-PA 619 CG45076-PA 311..545 14..229 158 25.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21225-PA 233 GI21225-PA 1..233 10..241 884 86.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17447-PA 232 GL17447-PA 1..232 10..241 902 88.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14072-PA 232 GA14072-PA 1..232 10..241 902 88.4 Plus
Dpse\GA14072-PB 230 GA14072-PB 1..230 10..241 848 85.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20580-PA 230 GM20580-PA 1..230 10..241 1061 97.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10052-PA 230 GD10052-PA 1..230 10..241 1061 97.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20829-PA 233 GJ20829-PA 1..233 10..241 843 83.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15615-PA 230 GK15615-PA 1..229 10..238 887 86 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22072-PA 230 GE22072-PA 1..230 10..241 1055 97 Plus

FI07350.hyp Sequence

Translation from 3 to 725

> FI07350.hyp
LAFRGPVSMFPSRQNQTSLKNFGDKTANLFSKKKDEAEKLANEKAAEAQK
LAEEQAKKVGQSVQQTKGEAEQLAASTAKEAAALATAEAQKAGQAIDQGV
NRAAGAVNQGKQAVDNTVAQAAAVAQNSKQVAANVAEASQRAAANAVDQT
KKAANDAINKSVKAAENVADQKLKQAEGAIDGALKQTSQTVDQKLQEANQ
YVDQKRQSVEKTVQDAAGQAQESAGQQANALLGKLHLGQK*

FI07350.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG1648-PB 232 CG1648-PB 1..232 9..240 1113 100 Plus
CG1648-PC 230 CG1648-PC 8..230 18..240 1065 100 Plus
CG1648-PA 230 CG1648-PA 8..230 18..240 1065 100 Plus
CG45076-PH 619 CG45076-PH 311..545 13..228 158 25.1 Plus
CG45076-PA 619 CG45076-PA 311..545 13..228 158 25.1 Plus