Clone FI07351 Report

Search the DGRC for FI07351

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:73
Well:51
Vector:pFlc-1
Associated Gene/TranscriptCG18067-RA
Protein status:FI07351.pep: gold
Sequenced Size:823

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18067 2008-08-15 Release 5.9 accounting
CG18067 2008-12-18 5.12 accounting

Clone Sequence Records

FI07351.complete Sequence

823 bp assembled on 2008-07-28

GenBank Submission: BT044330.1

> FI07351.complete
GATAGTCAATGCAAAATGGGCTCGAACACTGGAGCTTGGATTCTACTGGG
CCTGCTGGCCGGCATCGCCTCTCTGTCTAGCGCTGCGAATATACAGCGAA
ATGAGGACCAGACGATTCTTCAGAACAATGGAAACACCTTCCTATCAAAC
GGAGCCGGGCAAATCATTCGTGGACCCGATGGCAAAACAGTATTGATCGG
ATCCGATGGGCGCAGGATCATCACGGATGCCGACTCCAGCGAAGAGGACA
GCTCGCACGATTATGGTCACGGTGGGAGCTATAACAATGTTATCATCAAT
GGTGGCTCGGGATCCAGCGTAATTCATGGCGATGGACATAGCTTCATTGT
TGGAGATGCGAGTCATGGAAGTTACATGAACAGCAATGGACGCAGTATTA
GGATCATAAATGGTGCCATCGAACTCAATGATCACGGCCAGGTGTACACA
TTCAGGCCAAAAGCAGCAGGCATTAACGAAAAGGAAACCGTCACCATCAA
CGGACAACCGGCTCAGGTGGAGTACTCCAATGGTGATATAGTCATCGAAC
TGGCCGATCATACGGTGATTGCCAAGATAGGTGGACGCACATTTCTGGGC
GATCGCGAATCCTTCGACAATCGGGATAAATTAGAGGCGGAGGCAAAGAA
CTATGCCGATCGTATCCAGCAAGAGGTGCACGCCAATCTCCAGAAAACCA
TGGCTGATATTCAAAGGGATCTTCAGAATTCCCTGGGAAATATTTTCTAT
TAGAAGCCAAGTAATCAATCGTACACGAGTCGCTCGAAATAAAGCGCCTT
TGCAGCAAAAAAAAAAAAAAAAA

FI07351.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG18067-RA 1034 CG18067-RA 118..924 2..808 4035 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16421417..16422137 82..806 3455 98.8 Plus
chr2R 21145070 chr2R 16421278..16421358 2..82 405 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20534653..20535379 82..808 3635 100 Plus
2R 25286936 2R 20534512..20534592 2..82 405 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20535852..20536578 82..808 3635 100 Plus
2R 25260384 2R 20535711..20535791 2..82 405 100 Plus
Blast to na_te.dros performed on 2019-03-15 23:34:25 has no hits.

FI07351.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:35:22 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16421276..16421358 1..82 98 -> Plus
chr2R 16421418..16422137 83..806 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:44 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..738 16..753 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:40 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..738 16..753 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:50:54 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..738 16..753 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:07 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..738 16..753 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:39:57 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..738 16..753 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:23:33 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..785 1..784 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:40 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..785 1..784 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:50:54 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..805 2..806 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:21:59 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 1..785 1..784 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:39:57 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
CG18067-RA 2..808 1..806 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:22 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20534510..20534592 1..82 98 -> Plus
2R 20534654..20535377 83..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:22 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20534510..20534592 1..82 98 -> Plus
2R 20534654..20535377 83..806 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:35:22 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20534510..20534592 1..82 98 -> Plus
2R 20534654..20535377 83..806 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:50:54 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16422015..16422097 1..82 98 -> Plus
arm_2R 16422159..16422882 83..806 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:50 Download gff for FI07351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20535853..20536576 83..806 100   Plus
2R 20535709..20535791 1..82 98 -> Plus

FI07351.pep Sequence

Translation from 0 to 752

> FI07351.pep
DSQCKMGSNTGAWILLGLLAGIASLSSAANIQRNEDQTILQNNGNTFLSN
GAGQIIRGPDGKTVLIGSDGRRIITDADSSEEDSSHDYGHGGSYNNVIIN
GGSGSSVIHGDGHSFIVGDASHGSYMNSNGRSIRIINGAIELNDHGQVYT
FRPKAAGINEKETVTINGQPAQVEYSNGDIVIELADHTVIAKIGGRTFLG
DRESFDNRDKLEAEAKNYADRIQQEVHANLQKTMADIQRDLQNSLGNIFY
*

FI07351.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12271-PA 243 GF12271-PA 1..243 6..250 847 66.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22040-PA 245 GG22040-PA 1..245 6..250 1029 80 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21071-PA 292 GH21071-PA 66..288 39..248 393 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG18067-PB 245 CG18067-PB 1..245 6..250 1260 100 Plus
CG18067-PA 245 CG18067-PA 1..245 6..250 1260 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18671-PA 292 GI18671-PA 79..292 44..250 357 38.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17667-PA 255 GL17667-PA 6..255 12..250 571 48.4 Plus
Dper\GL17668-PA 165 GL17668-PA 4..159 51..211 200 31.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:12:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14779-PA 255 GA14779-PA 6..255 12..250 570 48.4 Plus
Dpse\GA24866-PA 165 GA24866-PA 4..159 51..211 207 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22023-PA 246 GM22023-PA 1..246 6..250 1140 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:12:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11521-PA 246 GD11521-PA 1..246 6..250 1142 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21687-PA 288 GJ21687-PA 45..288 19..250 394 39.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19306-PA 142 GK19306-PA 5..140 120..248 358 53.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:12:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12120-PA 245 GE12120-PA 1..245 6..250 938 73.5 Plus

FI07351.hyp Sequence

Translation from 1 to 752

> FI07351.hyp
HSQCKMGSNTGAWILLGLLAGIASLSSAANIQRNEDQTILQNNGNTFLSN
GAGQIIRGPDGKTVLIGSDGRRIITDADSSEEDSSHDYGHGGSYNNVIIN
GGSGSSVIHGDGHSFIVGDASHGSYMNSNGRSIRIINGAIELNDHGQVYT
FRPKAAGINEKETVTINGQPAQVEYSNGDIVIELADHTVIAKIGGRTFLG
DRESFDNRDKLEAEAKNYADRIQQEVHANLQKTMADIQRDLQNSLGNIFY
*

FI07351.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG18067-PB 245 CG18067-PB 1..245 6..250 1260 100 Plus
CG18067-PA 245 CG18067-PA 1..245 6..250 1260 100 Plus