Clone FI07507 Report

Search the DGRC for FI07507

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:75
Well:7
Vector:pFlc-1
Associated Gene/TranscriptCG9084-RB
Protein status:FI07507.pep: gold
Sequenced Size:926

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9084 2008-08-15 Release 5.9 accounting
CG9084 2008-12-18 5.12 accounting

Clone Sequence Records

FI07507.complete Sequence

926 bp assembled on 2008-07-29

GenBank Submission: BT044335.1

> FI07507.complete
GATTTCATTTAGACCGCCGTCAAATAAGTTTGAAAAGTGCTGGCGAAATG
TTGCAAAACAACGCGGTGCGCACTTTGCAATACGACAGTGAGATCCGTGT
GGCCCAGCAGCCAAGTCTCTCAGAACCGAGAGTTTATGACTCCCATATCA
GCATTACCTCACAACCCAGGCCGGAGGCTCCACGCATCCCGCTGCCAGTG
CCAATTGCCACGGTTACGGGAAGCCGGACGCTTATCCCACTTTCCGGATA
CGATTGCCTAGCAGATCTGCCGTCCGTACATATTGAACAGACCTTTGAGC
TTAACGATGCCCTAACAGGCGTCTCCTCGGAGAATCGATATGTGGTGCGA
TCTCCACTGGGTGATGCCATTTTCGCGGCCAACGAGAGTTCCACAGAAAA
AAATCGACTACTTTGGGGAGCTGGTCGACCCTTTCAGATGCACCTGCTGG
ATAAAACGCACCAGGAAGCTCTGGTTTTTCGCAAAAAACTAGCGATGGGA
TCCATGTGCTGCCAGGCAAAAAGTCTAGAAATTTGGATACCACCTGGTAA
TTTGCTGGGTAAAGTGGTGCAGTCGCCCACCTTCATGCAGCCGGAGTTCT
TTATCGAAGACGAAAGCACAGGACAACTAACATTCTGTGTAGAGGGTCCT
GTCGGTTTAGGATTCTGCTGCTTCAGTTTGCCCAAAGATTGTTATTTTAA
GATCCATTCGGGAGGCAATATGAGGGCTTCCATAGACCACAAATGGCTCG
CAAGCAAGTCTCAGTACACCACAAATATATACTTTAGTGACGCCAAGCTA
ACCGCCAAGGAGCGGGCTTTGATACTGGGATCAGCCTTTCTACTGGAATA
TCTATTCTTCCAAACCCGCTTTTGACGTGATTAATCAATAAAAAAAAACA
TTGTATATTCAAAAAAAAAAAAAAAA

FI07507.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG9084-RB 1072 CG9084-RB 128..1037 2..911 4535 99.8 Plus
nc_5973.b 135 nc_5973.b 94..135 132..173 210 100 Plus
nc_5973.a 190 nc_5973.a 150..190 133..173 205 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7105211..7105603 701..309 1965 100 Minus
chr2R 21145070 chr2R 7105663..7105841 309..131 865 98.9 Minus
chr2R 21145070 chr2R 7105003..7105149 846..700 720 99.3 Minus
chr2R 21145070 chr2R 7106540..7106670 132..2 640 99.2 Minus
chr2R 21145070 chr2R 7104873..7104938 910..845 315 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:18:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11217754..11218146 701..309 1965 100 Minus
2R 25286936 2R 11218206..11218384 309..131 895 100 Minus
2R 25286936 2R 11217546..11217692 846..700 720 99.3 Minus
2R 25286936 2R 11219083..11219213 132..2 655 100 Minus
2R 25286936 2R 11217415..11217481 911..845 335 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11218953..11219345 701..309 1965 100 Minus
2R 25260384 2R 11219405..11219583 309..131 895 100 Minus
2R 25260384 2R 11218745..11218891 846..700 720 99.3 Minus
2R 25260384 2R 11220282..11220412 132..2 655 100 Minus
2R 25260384 2R 11218614..11218680 911..845 335 100 Minus
Blast to na_te.dros performed on 2019-03-16 16:45:28 has no hits.

FI07507.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:46:41 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7104873..7104937 846..910 98 <- Minus
chr2R 7105004..7105147 702..845 99 <- Minus
chr2R 7105211..7105602 310..701 100 <- Minus
chr2R 7105663..7105839 133..309 98 <- Minus
chr2R 7106540..7106670 1..132 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:55:51 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..828 48..875 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:41 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..828 48..875 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:44:20 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..828 48..875 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:35 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..828 48..875 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:40:29 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..828 48..875 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:02 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..909 2..910 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:41 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..909 2..910 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:44:20 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 28..937 1..910 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:20:51 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 1..909 2..910 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:40:29 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
CG9084-RB 28..937 1..910 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:46:41 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11219083..11219213 1..132 99   Minus
2R 11217754..11218145 310..701 100 <- Minus
2R 11217416..11217480 846..910 100 <- Minus
2R 11217547..11217690 702..845 99 <- Minus
2R 11218206..11218382 133..309 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:46:41 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11219083..11219213 1..132 99   Minus
2R 11217754..11218145 310..701 100 <- Minus
2R 11217416..11217480 846..910 100 <- Minus
2R 11217547..11217690 702..845 99 <- Minus
2R 11218206..11218382 133..309 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:46:41 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11219083..11219213 1..132 99   Minus
2R 11217754..11218145 310..701 100 <- Minus
2R 11217416..11217480 846..910 100 <- Minus
2R 11217547..11217690 702..845 99 <- Minus
2R 11218206..11218382 133..309 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:44:20 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7104921..7104985 846..910 100 <- Minus
arm_2R 7105052..7105195 702..845 99 <- Minus
arm_2R 7105259..7105650 310..701 100 <- Minus
arm_2R 7105711..7105887 133..309 100 <- Minus
arm_2R 7106588..7106718 1..132 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:02 Download gff for FI07507.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11219405..11219581 133..309 100 <- Minus
2R 11220282..11220412 1..132 99   Minus
2R 11218953..11219344 310..701 100 <- Minus
2R 11218615..11218679 846..910 100 <- Minus
2R 11218746..11218889 702..845 99 <- Minus

FI07507.pep Sequence

Translation from 2 to 874

> FI07507.pep
FHLDRRQISLKSAGEMLQNNAVRTLQYDSEIRVAQQPSLSEPRVYDSHIS
ITSQPRPEAPRIPLPVPIATVTGSRTLIPLSGYDCLADLPSVHIEQTFEL
NDALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLD
KTHQEALVFRKKLAMGSMCCQAKSLEIWIPPGNLLGKVVQSPTFMQPEFF
IEDESTGQLTFCVEGPVGLGFCCFSLPKDCYFKIHSGGNMRASIDHKWLA
SKSQYTTNIYFSDAKLTAKERALILGSAFLLEYLFFQTRF*

FI07507.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12436-PA 376 GF12436-PA 130..376 44..290 1195 86.6 Plus
Dana\GF10228-PA 260 GF10228-PA 51..259 82..287 247 32.1 Plus
Dana\GF23835-PA 392 GF23835-PA 172..379 82..287 231 29 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22697-PA 275 GG22697-PA 1..275 16..290 1368 91.3 Plus
Dere\GG14486-PA 263 GG14486-PA 2..262 31..287 246 28 Plus
Dere\GG13979-PA 408 GG13979-PA 188..395 82..287 232 28.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20589-PA 275 GH20589-PA 1..274 16..289 1237 82.6 Plus
Dgri\GH16555-PA 378 GH16555-PA 125..365 58..287 246 27.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG9084-PB 275 CG9084-PB 1..275 16..290 1440 100 Plus
CG9084-PC 281 CG9084-PC 1..281 16..290 1423 97.9 Plus
CG9084-PE 145 CG9084-PE 1..145 146..290 775 100 Plus
CG9084-PD 145 CG9084-PD 1..145 146..290 775 100 Plus
scramb1-PB 233 CG32056-PB 13..220 82..287 236 29.1 Plus
scramb1-PC 332 CG32056-PC 112..319 82..287 236 29.1 Plus
scramb1-PA 416 CG32056-PA 196..403 82..287 236 29.1 Plus
scramb2-PA 263 CG1893-PA 54..262 82..287 231 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19735-PA 275 GI19735-PA 1..275 16..290 1224 80.5 Plus
Dmoj\GI13845-PA 380 GI13845-PA 160..367 82..287 241 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20642-PA 273 GL20642-PA 1..273 16..290 1316 87.4 Plus
Dper\GL11735-PA 399 GL11735-PA 179..386 82..287 232 28.2 Plus
Dper\GL11737-PA 247 GL11737-PA 39..246 82..287 229 28.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21529-PA 273 GA21529-PA 1..273 16..290 1316 87.4 Plus
Dpse\GA15113-PA 261 GA15113-PA 52..260 82..287 237 30.4 Plus
Dpse\GA16644-PA 397 GA16644-PA 177..384 82..287 233 28.2 Plus
Dpse\GA23464-PA 247 GA23464-PA 39..246 82..287 228 28.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20472-PA 275 GM20472-PA 1..275 16..290 1411 94.9 Plus
Dsec\GM14090-PA 263 GM14090-PA 54..262 82..287 242 30.8 Plus
Dsec\GM24815-PA 416 GM24815-PA 196..403 82..287 236 29.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25941-PA 275 GD25941-PA 1..275 16..290 1396 94.2 Plus
Dsim\GD13361-PA 263 GD13361-PA 54..262 82..287 238 30.4 Plus
Dsim\GD12867-PA 416 GD12867-PA 196..403 82..287 236 29.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18435-PA 275 GJ18435-PA 1..275 16..290 1236 81.6 Plus
Dvir\GJ11709-PA 410 GJ11709-PA 153..397 35..287 253 26.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20657-PA 275 GK20657-PA 1..275 16..290 1242 82.3 Plus
Dwil\GK17620-PA 271 GK17620-PA 62..270 82..287 251 31.8 Plus
Dwil\GK24075-PA 399 GK24075-PA 179..386 82..287 244 29.6 Plus
Dwil\GK23558-PA 240 GK23558-PA 62..217 82..239 209 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13050-PA 274 GE13050-PA 1..274 16..290 1361 91.3 Plus
Dyak\GE21674-PA 263 GE21674-PA 54..262 82..287 236 31.2 Plus
Dyak\GE20277-PA 408 GE20277-PA 188..395 82..287 232 29.4 Plus

FI07507.hyp Sequence

Translation from 2 to 874

> FI07507.hyp
FHLDRRQISLKSAGEMLQNNAVRTLQYDSEIRVAQQPSLSEPRVYDSHIS
ITSQPRPEAPRIPLPVPIATVTGSRTLIPLSGYDCLADLPSVHIEQTFEL
NDALTGVSSENRYVVRSPLGDAIFAANESSTEKNRLLWGAGRPFQMHLLD
KTHQEALVFRKKLAMGSMCCQAKSLEIWIPPGNLLGKVVQSPTFMQPEFF
IEDESTGQLTFCVEGPVGLGFCCFSLPKDCYFKIHSGGNMRASIDHKWLA
SKSQYTTNIYFSDAKLTAKERALILGSAFLLEYLFFQTRF*

FI07507.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:32:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG9084-PB 275 CG9084-PB 1..275 16..290 1440 100 Plus
CG9084-PC 281 CG9084-PC 1..281 16..290 1423 97.9 Plus
CG9084-PE 145 CG9084-PE 1..145 146..290 775 100 Plus
CG9084-PD 145 CG9084-PD 1..145 146..290 775 100 Plus
scramb1-PB 233 CG32056-PB 13..220 82..287 236 29.1 Plus