Clone FI07631 Report

Search the DGRC for FI07631

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:76
Well:31
Vector:pOT2
Associated Gene/TranscriptJupiter-RD
Protein status:FI07631.pep: gold
Sequenced Size:800

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Jupiter 2008-12-18 5.12 accounting

Clone Sequence Records

FI07631.complete Sequence

800 bp assembled on 2008-08-25

GenBank Submission: BT044341.1

> FI07631.complete
CGGCATCTGCAATTTTCTGTGCATTTCCACTTGCATTTTGTGTGTTTCAC
TTTGTTACGTGTGTGCCAGTTTTCCATTTAATCGTTACCGATCGTCCAAT
AAGCGGCTACAGCGGCAAAATGATCTCTAACTTTGATTGCACCGATAATC
AGGCCAGCAGCAAGGTGCTGAGGCCCCCGGGCGGCGGATCGAGCGACATC
TTTGGATCGGAGATGCCGCAGACCCCCAGGAACGTGAAGAATCGCATGGC
GTCCAACATATTCGCTGCCGAGAAAGATAATGGAGTGAAAAACAACGGTG
ATGCACCACGTCGCGGCCAGAAGACCGTCGACTCCCACTCTCGGCTGTTT
GGGGAGCCCACCCGCCCGATCACCCCCGGCAAGAACCACATGAAGAGCAG
CATTCCCTTTGGTCAGAACACAGAGGCCGTTGCCGCCCAGAAGCTGCTGA
CCACCAATGGCCACTACAACGGCAAGAGCGGATCGGTGTCCTCGGCCTCG
TCTTCGGTGTCGTCCTCCACCGAGAACCTCAAGATGAACAGTGGCTCGAG
ATCAGAGGGCAACCCCGTCACAGGCGAGGGCTACAAGGTCGTAGCCAACG
AGTATTCCCAGCGCCAGGAGTCGTCCAATGGCGGCACTCCGGTGATCAAC
AAGAACCGCATTCCCCCAGGCGGCTACTCGTCGGGCCTGTGGTAATGACA
GCCGGAATTGCTCAGATCCCAGCACAAGCAATTGAGGAGCCGATGGCGGG
ACGAGACACTATAAGAAAAAAAAAAAACCAACAAAAAAAAAAAAAAAAAA

FI07631.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
Jupiter-RD 1780 Jupiter-RD 135..933 1..799 3950 99.6 Plus
Jupiter.d 1978 Jupiter.d 68..622 1..555 2775 100 Plus
Jupiter-RH 1649 Jupiter-RH 464..966 297..799 2470 99.4 Plus
Jupiter-RH 1649 Jupiter-RH 135..431 1..297 1485 100 Plus
Jupiter.d 1978 Jupiter.d 1050..1295 554..799 1185 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:57:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7417858..7418116 555..297 1295 100 Minus
chr3R 27901430 chr3R 7416572..7416801 782..553 1150 100 Minus
chr3R 27901430 chr3R 7445224..7445387 164..1 805 99.4 Minus
chr3R 27901430 chr3R 7419122..7419261 299..160 685 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11592367..11592625 555..297 1295 100 Minus
3R 32079331 3R 11591064..11591310 799..553 1190 98.8 Minus
3R 32079331 3R 11619703..11619866 164..1 820 100 Minus
3R 32079331 3R 11593631..11593770 299..160 685 99.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11333198..11333456 555..297 1295 100 Minus
3R 31820162 3R 11331895..11332141 799..553 1190 98.7 Minus
3R 31820162 3R 11360534..11360697 164..1 820 100 Minus
3R 31820162 3R 11334462..11334601 299..160 685 99.2 Minus
Blast to na_te.dros performed on 2019-03-15 20:57:17 has no hits.

FI07631.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:58:11 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7445225..7445387 1..163 99   Minus
chr3R 7416589..7416798 556..765 100 <- Minus
chr3R 7417858..7418115 298..555 100 <- Minus
chr3R 7419124..7419257 164..297 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:46:14 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 1..576 120..695 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:29 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 1..576 120..695 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:32:38 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 1..576 120..695 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:49 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 1..576 120..695 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:51 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 1..576 120..695 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:46:12 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 69..833 1..765 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:29 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 69..833 1..765 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:32:38 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 41..805 1..765 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:05:21 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 69..833 1..765 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:51 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
Jupiter-RD 41..805 1..765 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:58:11 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11591098..11591307 556..765 100 <- Minus
3R 11592367..11592624 298..555 100 <- Minus
3R 11593633..11593766 164..297 100 <- Minus
3R 11619704..11619866 1..163 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:58:11 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11591098..11591307 556..765 100 <- Minus
3R 11592367..11592624 298..555 100 <- Minus
3R 11593633..11593766 164..297 100 <- Minus
3R 11619704..11619866 1..163 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:58:11 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11591098..11591307 556..765 100 <- Minus
3R 11592367..11592624 298..555 100 <- Minus
3R 11593633..11593766 164..297 100 <- Minus
3R 11619704..11619866 1..163 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:32:38 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7416820..7417029 556..765 100 <- Minus
arm_3R 7418089..7418346 298..555 100 <- Minus
arm_3R 7419355..7419488 164..297 100 <- Minus
arm_3R 7445426..7445588 1..163 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:41:45 Download gff for FI07631.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11360535..11360697 1..163 100   Minus
3R 11331929..11332138 556..765 100 <- Minus
3R 11333198..11333455 298..555 100 <- Minus
3R 11334464..11334597 164..297 100 <- Minus

FI07631.pep Sequence

Translation from 2 to 694

> FI07631.pep
ASAIFCAFPLAFCVFHFVTCVPVFHLIVTDRPISGYSGKMISNFDCTDNQ
ASSKVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDNGVKNNGD
APRRGQKTVDSHSRLFGEPTRPITPGKNHMKSSIPFGQNTEAVAAQKLLT
TNGHYNGKSGSVSSASSSVSSSTENLKMNSGSRSEGNPVTGEGYKVVANE
YSQRQESSNGGTPVINKNRIPPGGYSSGLW*

FI07631.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:23:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16635-PA 354 GF16635-PA 17..163 50..183 530 85 Plus
Dana\GF16635-PA 354 GF16635-PA 300..354 176..230 204 69.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17211-PA 345 GG17211-PA 1..157 40..184 705 91.7 Plus
Dere\GG17211-PA 345 GG17211-PA 300..345 185..230 219 87 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17288-PA 207 GH17288-PA 17..207 50..230 632 74.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Jupiter-PD 191 CG31363-PD 1..191 40..230 997 100 Plus
Jupiter-PA 197 CG31363-PA 1..197 40..230 976 96.4 Plus
Jupiter-PH 202 CG31363-PH 1..202 40..230 975 94.6 Plus
Jupiter-PC 197 CG31363-PC 17..197 50..230 925 97.8 Plus
Jupiter-PE 208 CG31363-PE 17..208 50..230 903 92.2 Plus
Jupiter-PI 105 CG31363-PI 1..98 40..137 316 71 Plus
Jupiter-PI 105 CG31363-PI 52..105 177..230 256 88.9 Plus
Jupiter-PB 185 CG31363-PB 140..185 185..230 250 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23754-PA 203 GI23754-PA 17..203 50..230 548 67.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12395-PA 361 GL12395-PA 1..166 40..184 541 78.3 Plus
Dper\GL12395-PA 361 GL12395-PA 307..361 185..230 147 54.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27493-PD 160 GA27493-PD 1..63 40..102 271 79.4 Plus
Dpse\GA27493-PB 153 GA27493-PB 1..63 40..102 269 79.4 Plus
Dpse\GA27493-PC 164 GA27493-PC 1..58 40..97 260 82.8 Plus
Dpse\GA27493-PE 159 GA27493-PE 17..69 50..102 222 77.4 Plus
Dpse\GA27493-PF 170 GA27493-PF 17..64 50..97 213 81.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26090-PA 315 GM26090-PA 1..145 40..184 745 100 Plus
Dsec\GM26090-PA 315 GM26090-PA 272..315 185..230 212 87 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20653-PA 168 GD20653-PA 1..156 40..184 728 92.9 Plus
Dsim\GD15110-PA 183 GD15110-PA 140..183 185..230 211 87 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10600-PA 205 GJ10600-PA 17..205 50..230 548 68.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11035-PA 368 GK11035-PA 17..169 50..184 474 74.5 Plus
Dwil\GK11035-PA 368 GK11035-PA 324..368 185..230 149 65.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10105-PA 347 GE10105-PA 1..157 40..184 700 91.1 Plus
Dyak\GE10105-PA 347 GE10105-PA 302..347 185..230 210 82.6 Plus

FI07631.hyp Sequence

Translation from 2 to 694

> FI07631.hyp
ASAIFCAFPLAFCVFHFVTCVPVFHLIVTDRPISGYSGKMISNFDCTDNQ
ASSKVLRPPGGGSSDIFGSEMPQTPRNVKNRMASNIFAAEKDNGVKNNGD
APRRGQKTVDSHSRLFGEPTRPITPGKNHMKSSIPFGQNTEAVAAQKLLT
TNGHYNGKSGSVSSASSSVSSSTENLKMNSGSRSEGNPVTGEGYKVVANE
YSQRQESSNGGTPVINKNRIPPGGYSSGLW*

FI07631.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
Jupiter-PD 191 CG31363-PD 1..191 40..230 997 100 Plus
Jupiter-PA 197 CG31363-PA 1..197 40..230 976 96.4 Plus
Jupiter-PH 202 CG31363-PH 1..202 40..230 975 94.6 Plus
Jupiter-PC 197 CG31363-PC 17..197 50..230 925 97.8 Plus
Jupiter-PE 208 CG31363-PE 17..208 50..230 903 92.2 Plus