Clone FI07632 Report

Search the DGRC for FI07632

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:76
Well:32
Vector:pOT2
Associated Gene/TranscriptBub3-RA
Protein status:FI07632.pep: gold
Sequenced Size:1231

Clone Sequence Records

FI07632.complete Sequence

1231 bp assembled on 2009-05-13

GenBank Submission: BT083437.1

> FI07632.complete
CAAATTCGGAGTTTGATTTGTTTTAAGCAGTTTCTGTTTGAATTTATTGT
TTTATTATCCACAAGTTGCTAGCAGAAAACTTGACAAAATGCGTCCCCCA
GAGTTCAAGCTTAACAATCCGCCGGAGGACCTGATCTCCGCTGTGAAATT
CGGCCCCAAATCGAATCAATACATGGCGGCGTCTTCTTGGGACGGAACAC
TTAGATTCTATGATGTGCCGGCAAACCAGCTGCGTCAGAAATTCGTGCAG
GATGCCCCTCTTCTCGACTGTGCCTTCATGGACATAGTGCACGTGGTCAG
TGGCTCCCTGGACAACCAGCTGCGTCTCTTTGATGTCAACACCCAGGCGG
AAAGCATAATTGGTGCCCACGAGGAGCCCATCAGATGCGTGGAGCACGCC
GAGTATGTCAATGGCATCCTCACGGGTAGCTGGGACAATACCGTGAAGCT
GTGGGACATGCGGGAGAAGCGCTGCGTTGGAACCTTCGAACAGAACAACG
GAAAGGTGTACTCCATGTCCGTGATCGACGAAAAGATCGTGGTGGCCACC
TCCGACCGCAAGGTGCTCATCTGGGACCTTCGCAAGATGGACAGCTACAT
CATGAAGCGGGAGTCCTCGCTCAAGTACCAGACCCGCTGCATTCGTCTAT
TCCCCAACAAAGAAGGCTACGTGATGTCCTCCATCGAGGGACGGGTGGCA
GTGGAGTACCTGGATCACGATCCTGAGGTGCAGCGCCGCAAGTTCGCTTT
CAAGTGCCACCGGAATAGGGAGCAGAATATCGAACAGATCTACCCCGTTA
ATGCCTTGAGTTTCCACAATGTCTATCAGACGTTCGCCACTGGCGGATCC
GATGGCATTGTGAACATTTGGGATGGCTTCAACAAGAAGCGCCTTTGTCA
GTTCCACGAATACGATACCTCCATATCCACGCTCAACTTCAGCTCCGATG
GCAGCGCCCTGGCCATCGGCTGCTCCTACTTGGACCAACTGCCAGAGACG
CCGGCTACAGTGCCACATCCGGCTATCTATATACGCTATCCCACGGACCA
GGAAACTAAACAGAAATAATGTTATATATACTTGTTTACGGCAAAGTTTT
ACATCATTTTTTAAAGTAAGCTACTTAGTATACTCTTTCAATTTTATGCG
CGCATCTCTGATGAAACCCCACATCAGTTTTCCCAGCACAAATAAAAGCT
CTATAAAACTCAAAAAAAAAAAAAAAAAAAA

FI07632.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:26:23
Subject Length Description Subject Range Query Range Score Percent Strand
Bub3-RA 1390 Bub3-RA 41..1252 1..1212 6060 100 Plus
ppk19-RA 1536 ppk19-RA 1445..1536 1212..1121 460 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:43:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25496750..25497681 1211..280 4660 100 Minus
chr3R 27901430 chr3R 25497733..25498013 281..1 1375 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29674132..29675064 1212..280 4665 100 Minus
3R 32079331 3R 29675116..29675396 281..1 1405 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29414963..29415895 1212..280 4665 100 Minus
3R 31820162 3R 29415947..29416227 281..1 1405 100 Minus
Blast to na_te.dros performed on 2019-03-16 13:43:42 has no hits.

FI07632.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:44:22 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25496750..25497680 281..1211 100 <- Minus
chr3R 25497734..25498013 1..280 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:53:48 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 1..981 89..1069 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:52:09 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 1..981 89..1069 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:30:14 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 1..981 89..1069 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:08 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 1..981 89..1069 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-13 19:04:56 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 24..1234 1..1211 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:52:09 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 24..1234 1..1211 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:30:14 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 26..1236 1..1211 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:08 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
Bub3-RA 26..1236 1..1211 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:22 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29674133..29675063 281..1211 100 <- Minus
3R 29675117..29675396 1..280 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:22 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29674133..29675063 281..1211 100 <- Minus
3R 29675117..29675396 1..280 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:22 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29674133..29675063 281..1211 100 <- Minus
3R 29675117..29675396 1..280 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:30:14 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25500839..25501118 1..280 100   Minus
arm_3R 25499855..25500785 281..1211 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:42:57 Download gff for FI07632.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29414964..29415894 281..1211 100 <- Minus
3R 29415948..29416227 1..280 100   Minus

FI07632.hyp Sequence

Translation from 88 to 1068

> FI07632.hyp
MRPPEFKLNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQ
KFVQDAPLLDCAFMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRC
VEHAEYVNGILTGSWDNTVKLWDMREKRCVGTFEQNNGKVYSMSVIDEKI
VVATSDRKVLIWDLRKMDSYIMKRESSLKYQTRCIRLFPNKEGYVMSSIE
GRVAVEYLDHDPEVQRRKFAFKCHRNREQNIEQIYPVNALSFHNVYQTFA
TGGSDGIVNIWDGFNKKRLCQFHEYDTSISTLNFSSDGSALAIGCSYLDQ
LPETPATVPHPAIYIRYPTDQETKQK*

FI07632.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:34:29
Subject Length Description Subject Range Query Range Score Percent Strand
Bub3-PB 326 CG7581-PB 1..326 1..326 1735 100 Plus
Bub3-PA 326 CG7581-PA 1..326 1..326 1735 100 Plus
Rae1-PA 346 CG9862-PA 10..315 2..297 401 32.4 Plus
CG12782-PA 336 CG12782-PA 14..308 5..297 286 27.8 Plus
Gbeta5-PA 358 CG10763-PA 83..348 27..294 203 23.3 Plus

FI07632.pep Sequence

Translation from 88 to 1068

> FI07632.pep
MRPPEFKLNNPPEDLISAVKFGPKSNQYMAASSWDGTLRFYDVPANQLRQ
KFVQDAPLLDCAFMDIVHVVSGSLDNQLRLFDVNTQAESIIGAHEEPIRC
VEHAEYVNGILTGSWDNTVKLWDMREKRCVGTFEQNNGKVYSMSVIDEKI
VVATSDRKVLIWDLRKMDSYIMKRESSLKYQTRCIRLFPNKEGYVMSSIE
GRVAVEYLDHDPEVQRRKFAFKCHRNREQNIEQIYPVNALSFHNVYQTFA
TGGSDGIVNIWDGFNKKRLCQFHEYDTSISTLNFSSDGSALAIGCSYLDQ
LPETPATVPHPAIYIRYPTDQETKQK*

FI07632.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22876-PA 326 GF22876-PA 1..326 1..326 1727 96 Plus
Dana\GF11632-PA 336 GF11632-PA 3..305 5..297 435 33.7 Plus
Dana\GF13306-PA 373 GF13306-PA 27..334 5..297 258 26.8 Plus
Dana\GF20976-PA 358 GF20976-PA 83..348 27..294 207 23.3 Plus
Dana\GF23256-PA 424 GF23256-PA 167..362 14..196 158 25.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20758-PA 346 GG20758-PA 13..315 5..297 415 32.4 Plus
Dere\GG20054-PA 335 GG20054-PA 14..310 5..297 269 26.4 Plus
Dere\GG17982-PA 358 GG17982-PA 83..348 27..294 207 23.3 Plus
Dere\GG14860-PA 510 GG14860-PA 320..489 3..164 159 25 Plus
Dere\GG14203-PA 1329 GG14203-PA 1047..1185 25..164 150 24.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18686-PA 326 GH18686-PA 1..326 1..326 1624 90.2 Plus
Dgri\GH23041-PA 347 GH23041-PA 14..316 5..297 415 32 Plus
Dgri\GH24861-PA 357 GH24861-PA 82..347 27..294 206 23.3 Plus
Dgri\GH15796-PA 510 GH15796-PA 320..489 3..164 159 25 Plus
Dgri\anon-2-PA 1411 GH15539-PA 1129..1267 25..164 150 24.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:20
Subject Length Description Subject Range Query Range Score Percent Strand
Bub3-PB 326 CG7581-PB 1..326 1..326 1735 100 Plus
Bub3-PA 326 CG7581-PA 1..326 1..326 1735 100 Plus
Rae1-PA 346 CG9862-PA 10..315 2..297 401 32.4 Plus
CG12782-PA 336 CG12782-PA 14..308 5..297 286 27.8 Plus
Gbeta5-PA 358 CG10763-PA 83..348 27..294 203 23.3 Plus
slmb-PC 510 CG3412-PC 334..488 17..163 152 25.5 Plus
slmb-PA 510 CG3412-PA 334..488 17..163 152 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24196-PA 326 GI24196-PA 1..326 1..326 1629 90.2 Plus
Dmoj\GI21110-PA 349 GI21110-PA 14..318 5..297 411 31.8 Plus
Dmoj\GI14411-PA 356 GI14411-PA 81..346 27..294 206 23.3 Plus
Dmoj\GI23727-PA 510 GI23727-PA 320..489 3..164 159 25 Plus
Dmoj\GI23133-PA 339 GI23133-PA 183..331 18..162 152 25.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13583-PA 326 GL13583-PA 1..326 1..326 1701 94.8 Plus
Dper\GL11275-PA 347 GL11275-PA 13..316 5..297 421 32.9 Plus
Dper\GL20190-PA 356 GL20190-PA 81..346 27..294 206 23.3 Plus
Dper\GL27199-PA 344 GL27199-PA 188..337 18..163 159 25.8 Plus
Dper\GL22031-PA 507 GL22031-PA 317..486 3..164 159 25 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:24:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20454-PA 326 GA20454-PA 1..326 1..326 1701 94.8 Plus
Dpse\GA22080-PA 347 GA22080-PA 13..316 5..297 421 32.9 Plus
Dpse\GA10552-PA 356 GA10552-PA 81..346 27..294 206 23.3 Plus
Dpse\GA17766-PA 440 GA17766-PA 284..433 18..163 159 25.8 Plus
Dpse\GA27349-PA 507 GA27349-PA 317..486 3..164 159 25 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12232-PA 326 GM12232-PA 1..326 1..326 1768 99.4 Plus
Dsec\GM15702-PA 346 GM15702-PA 13..315 5..297 412 32.4 Plus
Dsec\GM15568-PA 336 GM15568-PA 14..308 5..297 273 27.1 Plus
Dsec\GM11205-PA 358 GM11205-PA 83..348 27..294 207 23.3 Plus
Dsec\GM15099-PA 510 GM15099-PA 320..489 3..164 159 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17697-PA 326 GD17697-PA 1..326 1..326 1768 99.4 Plus
Dsim\GD25070-PA 336 GD25070-PA 14..308 5..297 278 27.5 Plus
Dsim\GD16125-PA 358 GD16125-PA 83..348 27..294 207 23.3 Plus
Dsim\GD25180-PA 173 GD25180-PA 13..142 5..126 184 32.8 Plus
Dsim\GD20006-PA 510 GD20006-PA 320..489 3..164 159 25 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10544-PA 326 GJ10544-PA 1..326 1..326 1647 91.1 Plus
Dvir\GJ20959-PA 349 GJ20959-PA 14..318 5..297 414 32.1 Plus
Dvir\GJ20971-PA 333 GJ20971-PA 7..304 5..297 382 31.6 Plus
Dvir\GJ18759-PA 356 GJ18759-PA 81..346 27..294 207 23.3 Plus
Dvir\GJ23285-PA 510 GJ23285-PA 320..489 3..164 159 25 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:24:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11174-PA 326 GK11174-PA 1..326 1..326 1652 91.7 Plus
Dwil\GK19577-PA 348 GK19577-PA 10..317 2..297 411 31.5 Plus
Dwil\GK19916-PA 356 GK19916-PA 81..346 27..294 205 22.6 Plus
Dwil\GK10412-PA 414 GK10412-PA 21..286 16..292 162 24 Plus
Dwil\GK10973-PA 424 GK10973-PA 167..362 14..196 161 26.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10441-PA 326 GE10441-PA 1..326 1..326 1763 98.8 Plus
Dyak\GE13690-PA 346 GE13690-PA 13..315 5..297 415 32.4 Plus
Dyak\GE11590-PA 337 GE11590-PA 14..315 5..297 254 26.7 Plus
Dyak\GE17476-PA 358 GE17476-PA 83..348 27..294 207 23.3 Plus
Dyak\GE25013-PA 487 GE25013-PA 297..466 3..164 160 25 Plus