Clone FI07634 Report

Search the DGRC for FI07634

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:76
Well:34
Vector:pOT2
Associated Gene/TranscriptCG6891-RA
Protein status:FI07634.pep: gold
Sequenced Size:982

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6891 2008-12-18 5.12 accounting

Clone Sequence Records

FI07634.complete Sequence

982 bp assembled on 2008-08-25

GenBank Submission: BT044342.1

> FI07634.complete
TCGGACGAAGTTCAGCGGCTGCTCTAATATCTGGATATCTGGAACTGTGC
TGGTTCTGTCCATCGCTCTTTGTGCGCTTGGATTGTGTTTTTTTGTTGTT
TTTCTGGCGCTGTGTATTTTTGTTTTCGTTGTCATTGTGCCACTCTGCCA
CTCTGCCACTTTGTCACCTTGCAAACGGTCAACTCTTCCCGCCAGACCAG
CACTCCGTTCCCCTTCGAGACTCACCCGCGATCCCAGGAAGCTGTTCCCA
AGAGCACCAGCATCCCAGCTGCGCATTGAAAACCATATCTACATCCACAT
CCAGAACACAGCGCACCAGCATGTCGGACGGCATCGAGGTCGAGCAATTG
GTGGAGAGCAAGCCGAGAAGGATGCCGCTGGCCACGTCGCTGGAGAAGGA
CTCGATTCGCGAGGCCTACGAGGATGTACGCTCCGATCTGACAGACACCG
AGTGGGCGGTATTCAAGTTCGATGGCGCCCAGATTATTGTACATGCGCGC
GGTCAGTGCTTTGAGGAATTCCGACAGCAGTTCGGCGACTCGGAGCGCGC
CTTTGGCTACATACGCATCCAGATGGGTGACGAGATGTCCAAGCGCAAAA
AGTTCATCTTCCTGACGTGGATCGGGCAGGAGGTGGGCGTCATCCAGAGG
GCCAAGATGTCCACGGACAAGGCGCTGATCAAGGATGTCCTCAACAATTT
TGCCGTGGAACTTCAGGCGGGAGTGGAGGCCGAGCTGGACATTGAGCTCT
TCCGTGAAGCACTGAACCGTGCCGGCGGCGCCAACTACGGAACGGGCATC
CGGGATAACTAAGCGGCCTCCAAGTTACTTTACATATACATTTTTTTTTG
CAACTCTTAACTGCTTACCAAACTGCTCCTTTCTCTTTAATTATTATGAA
TTAATTTTATGAAATTTAAAAACTGTACATTTTATGAAATATTATACAAG
CAATTGTAACATTAAAAAAAAAAAAAAAAAAA

FI07634.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG6891-RA 1146 CG6891-RA 151..1114 1..964 4820 100 Plus
CG6891-RB 821 CG6891-RB 193..789 368..964 2985 100 Plus
CG6891.d 718 CG6891.d 94..686 372..964 2965 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18664365..18664735 1..371 1855 100 Plus
chrX 22417052 chrX 18669776..18670100 371..695 1580 99.1 Plus
chrX 22417052 chrX 18670174..18670441 696..963 1325 99.6 Plus
chrX 22417052 chrX 18674885..18675026 554..695 635 96.5 Plus
chrX 22417052 chrX 18675192..18675291 860..959 500 100 Plus
chrX 22417052 chrX 18675100..18675172 696..768 365 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18775259..18775629 1..371 1855 100 Plus
X 23542271 X 18780680..18781004 371..695 1625 100 Plus
X 23542271 X 18781078..18781346 696..964 1345 100 Plus
X 23542271 X 18785786..18785927 554..695 650 97.2 Plus
X 23542271 X 18786093..18786192 860..959 500 100 Plus
X 23542271 X 18786001..18786073 696..768 365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18783357..18783727 1..371 1855 100 Plus
X 23527363 X 18788778..18789102 371..695 1625 100 Plus
X 23527363 X 18789176..18789444 696..964 1345 100 Plus
X 23527363 X 18793884..18794025 554..695 650 97.1 Plus
X 23527363 X 18794191..18794290 860..959 500 100 Plus
X 23527363 X 18794099..18794171 696..768 365 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:46:55 has no hits.

FI07634.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:47:45 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18664365..18664735 1..371 100 -> Plus
chrX 18669777..18670100 372..695 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:56:19 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 1..492 321..812 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:30 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 1..492 321..812 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:30:30 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 1..492 321..812 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:49 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 1..492 321..812 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:24:35 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 1..492 321..812 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:08:43 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 30..992 1..963 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:30 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 30..992 1..963 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:30:30 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 32..994 1..963 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:05:25 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 30..992 1..963 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:24:35 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
CG6891-RA 32..994 1..963 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:45 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
X 18775259..18775629 1..371 100 -> Plus
X 18780681..18781004 372..695 100 -> Plus
X 18781078..18781345 696..963 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:45 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
X 18775259..18775629 1..371 100 -> Plus
X 18780681..18781004 372..695 100 -> Plus
X 18781078..18781345 696..963 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:47:45 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
X 18775259..18775629 1..371 100 -> Plus
X 18780681..18781004 372..695 100 -> Plus
X 18781078..18781345 696..963 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:30:30 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18669292..18669662 1..371 100 -> Plus
arm_X 18674714..18675037 372..695 100 -> Plus
arm_X 18675111..18675378 696..963 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:41:47 Download gff for FI07634.complete
Subject Subject Range Query Range Percent Splice Strand
X 18783357..18783727 1..371 100 -> Plus
X 18788779..18789102 372..695 100 -> Plus
X 18789176..18789443 696..963 100   Plus

FI07634.hyp Sequence

Translation from 2 to 811

> FI07634.hyp
GRSSAAALISGYLELCWFCPSLFVRLDCVFLLFFWRCVFLFSLSLCHSAT
LPLCHLANGQLFPPDQHSVPLRDSPAIPGSCSQEHQHPSCALKTISTSTS
RTQRTSMSDGIEVEQLVESKPRRMPLATSLEKDSIREAYEDVRSDLTDTE
WAVFKFDGAQIIVHARGQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKK
FIFLTWIGQEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELF
REALNRAGGANYGTGIRDN*

FI07634.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:34:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG6891-PA 163 CG6891-PA 1..163 107..269 829 100 Plus
CG6891-PC 146 CG6891-PC 1..146 124..269 746 100 Plus
CG6891-PB 146 CG6891-PB 1..146 124..269 746 100 Plus

FI07634.pep Sequence

Translation from 2 to 811

> FI07634.pep
GRSSAAALISGYLELCWFCPSLFVRLDCVFLLFFWRCVFLFSLSLCHSAT
LPLCHLANGQLFPPDQHSVPLRDSPAIPGSCSQEHQHPSCALKTISTSTS
RTQRTSMSDGIEVEQLVESKPRRMPLATSLEKDSIREAYEDVRSDLTDTE
WAVFKFDGAQIIVHARGQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKK
FIFLTWIGQEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELF
REALNRAGGANYGTGIRDN*

FI07634.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19083-PA 163 GF19083-PA 1..162 107..268 827 96.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19183-PA 163 GG19183-PA 1..163 107..269 861 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12531-PA 163 GH12531-PA 1..163 107..269 829 94.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG6891-PA 163 CG6891-PA 1..163 107..269 829 100 Plus
CG6891-PC 146 CG6891-PC 1..146 124..269 746 100 Plus
CG6891-PB 146 CG6891-PB 1..146 124..269 746 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11191-PA 163 GI11191-PA 1..163 107..269 829 93.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26993-PA 163 GL26993-PA 1..163 107..269 823 95.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19933-PA 163 GA19933-PA 1..163 107..269 820 94.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22913-PA 163 GM22913-PA 1..163 107..269 861 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17404-PA 163 GD17404-PA 1..163 107..269 861 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:23:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18476-PA 163 GJ18476-PA 1..163 107..269 837 95.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10196-PA 163 GK10196-PA 1..163 107..269 822 94.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17746-PA 163 GE17746-PA 1..163 107..269 861 100 Plus