Clone FI07636 Report

Search the DGRC for FI07636

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:76
Well:36
Vector:pOT2
Associated Gene/TranscriptNon3-RA
Protein status:FI07636.pep: gold
Sequenced Size:1071

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7993 2008-12-18 5.12 accounting

Clone Sequence Records

FI07636.complete Sequence

1071 bp assembled on 2008-09-15

GenBank Submission: BT044511.1

> FI07636.complete
TGAATTATAGTTTATTTGACTTGGTTTTTATTTCAAAACATTTAAATATG
TCGCTTTTACGCATCAGGAAACCAAAAACCCGCAAGGGAAAGAAGGTGTT
GCTGGCCAGGGAGCCGCAACTCATTGAATCCGCCCGCACAATGCTGTTTT
TGGACGGAAGGAAGTGCGGCGGCAATGTGAAGCTGTGCATGAAGGACCTG
CAGGCGCTGAAGAAGCCGCTGGTTAAAGTGCTGAACCGCAAAAACGACAT
TACCCCCTTTGACGATCCCTCATCTCTGGAGTTCTTGACCATGAAGAACG
ATGCTGCTTTGTTCACGTTCGGTTCCACGTCCAAGAAGCGACCCGATAAC
ATTATACTGGGCAGGATCTTCGAGAACGAGGTGCTGGACATGTTTGAACT
GGGCATCAAGCGGTATCAGGCGATTTCCGAGTTTAAGAACGAGAAAATCG
GAGCCTGCGTCAAGCCCTGCCTGGTGTTCAATGGTCCGAAATGGGCACAG
ACCGAGGAACTGAGGCGCCTTCGCAACCTGTTCATCGACACCTTCCAGCG
CGAGAAGGTGGATTCGATCCGGCTGCAGGGCATCGAACACGTTCTGAGTT
TCACGGTTACCGATGACATGAACATACTGATGCGTTCCTACCGGATACTG
CTGAAGAAATCTGGCCAGAGGACGCCGCGCATAGAGCTTGAAGAGATCGG
ACCCTCGGCCGACTTCTCCATTCGCCGCACCAAGATCGCCAGCGAGGATC
TGTACAAACAGGCACGCAAACAGCCCAAGCAGTTGAAGGTGGGCAAGAAG
AAGAACATTAGCACAGACGCCCTGGGCAACACCAAGGGACGTGTCCATCT
GGGCAAGCAGCAAACGGGCTCCATTCAAACGCGTCGCGTCAAGGCGCTGC
GTAAGACGCCGGAGGAGAAGAAGGAGAACCGACAGCGCAAGAAGGTTGCT
CTGAAGGCGGCCGCCGCCGAAGCACTGGCCTCACAAGGAAACAATCCCTT
CTCTAGTTAATTTTAGTTGTAATAAATTGGTCCTGATTAAATTAAAAAAG
AAAAAAAAAAAAAAAAAAAAA

FI07636.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7993-RA 1140 CG7993-RA 46..1089 1..1044 5220 100 Plus
CG7168-RA 1058 CG7168-RA 1001..1058 1044..987 290 100 Minus
CG7168.c 1030 CG7168.c 989..1030 1044..1003 210 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-17 00:13:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14048477..14049237 284..1044 3805 100 Plus
chr3R 27901430 chr3R 14048190..14048408 65..283 1095 100 Plus
chr3R 27901430 chr3R 14048066..14048133 1..68 340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18224183..18224943 284..1044 3805 100 Plus
3R 32079331 3R 18223896..18224114 65..283 1095 100 Plus
3R 32079331 3R 18223772..18223839 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17965014..17965774 284..1044 3805 100 Plus
3R 31820162 3R 17964727..17964945 65..283 1095 100 Plus
3R 31820162 3R 17964603..17964670 1..68 340 100 Plus
Blast to na_te.dros performed on 2019-03-17 00:13:04 has no hits.

FI07636.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 00:13:39 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14048066..14048132 1..67 100 -> Plus
chr3R 14048193..14048408 68..283 100 -> Plus
chr3R 14048477..14049237 284..1044 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:56:20 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
CG7993-RA 1..963 48..1010 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:01:34 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
CG7993-RA 1..963 48..1010 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:32:15 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
CG7993-RA 1..963 48..1010 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:14:35 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
Non3-RA 1..963 48..1010 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:19:59 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
CG7993-RA 46..1088 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:01:34 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
CG7993-RA 46..1088 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:32:15 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
CG7993-RA 51..1093 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-09-15 12:13:53 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
CG7993-RA 46..1088 1..1043 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:14:35 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
Non3-RA 51..1093 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:39 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18223772..18223838 1..67 100 -> Plus
3R 18223899..18224114 68..283 100 -> Plus
3R 18224183..18224943 284..1044 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:39 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18223772..18223838 1..67 100 -> Plus
3R 18223899..18224114 68..283 100 -> Plus
3R 18224183..18224943 284..1044 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 00:13:39 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18223772..18223838 1..67 100 -> Plus
3R 18223899..18224114 68..283 100 -> Plus
3R 18224183..18224943 284..1044 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:32:15 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14049494..14049560 1..67 100 -> Plus
arm_3R 14049621..14049836 68..283 100 -> Plus
arm_3R 14049905..14050665 284..1044 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:29:02 Download gff for FI07636.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17964730..17964945 68..283 100 -> Plus
3R 17965014..17965774 284..1044 100   Plus
3R 17964603..17964669 1..67 100 -> Plus

FI07636.hyp Sequence

Translation from 2 to 1009

> FI07636.hyp
NYSLFDLVFISKHLNMSLLRIRKPKTRKGKKVLLAREPQLIESARTMLFL
DGRKCGGNVKLCMKDLQALKKPLVKVLNRKNDITPFDDPSSLEFLTMKND
AALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKNEKIG
ACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSF
TVTDDMNILMRSYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDL
YKQARKQPKQLKVGKKKNISTDALGNTKGRVHLGKQQTGSIQTRRVKALR
KTPEEKKENRQRKKVALKAAAAEALASQGNNPFSS*

FI07636.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:34:36
Subject Length Description Subject Range Query Range Score Percent Strand
Non3-PA 320 CG7993-PA 1..320 16..335 1614 100 Plus

FI07636.pep Sequence

Translation from 2 to 1009

> FI07636.pep
NYSLFDLVFISKHLNMSLLRIRKPKTRKGKKVLLAREPQLIESARTMLFL
DGRKCGGNVKLCMKDLQALKKPLVKVLNRKNDITPFDDPSSLEFLTMKND
AALFTFGSTSKKRPDNIILGRIFENEVLDMFELGIKRYQAISEFKNEKIG
ACVKPCLVFNGPKWAQTEELRRLRNLFIDTFQREKVDSIRLQGIEHVLSF
TVTDDMNILMRSYRILLKKSGQRTPRIELEEIGPSADFSIRRTKIASEDL
YKQARKQPKQLKVGKKKNISTDALGNTKGRVHLGKQQTGSIQTRRVKALR
KTPEEKKENRQRKKVALKAAAAEALASQGNNPFSS*

FI07636.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:39:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23070-PA 314 GF23070-PA 1..297 16..312 1520 96.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22748-PA 320 GG22748-PA 1..320 16..335 1666 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:39:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18556-PA 314 GH18556-PA 1..296 16..311 1444 89.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Non3-PA 320 CG7993-PA 1..320 16..335 1614 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24755-PA 314 GI24755-PA 1..312 16..327 1478 92.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:39:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12003-PA 314 GL12003-PA 1..296 16..311 1423 89.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20749-PA 314 GA20749-PA 1..296 16..311 1423 89.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:40:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15289-PA 320 GM15289-PA 1..320 16..335 1670 99.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19216-PA 320 GD19216-PA 1..320 16..335 1677 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:40:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22542-PA 314 GJ22542-PA 1..300 16..315 1462 91.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22384-PA 312 GK22384-PA 1..312 16..327 1473 92 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25522-PA 320 GE25522-PA 1..320 16..335 1673 99.4 Plus