Clone FI07654 Report

Search the DGRC for FI07654

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:76
Well:54
Vector:pOT2
Associated Gene/TranscriptCG6836-RA
Protein status:FI07654.pep: gold
Sequenced Size:1309

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6836 2008-08-15 Release 5.9 accounting
CG6836 2008-12-18 5.12 accounting

Clone Sequence Records

FI07654.complete Sequence

1309 bp assembled on 2008-08-14

GenBank Submission: BT044348.1

> FI07654.complete
TGCGAGCGAATAAGACACACGCGGCTAAAAAATTGCTTGAAAAGCTGAGA
AAACAGGGAGTGTGAAGTATACATGTATGAGTGCTAATGAGGTGCAAAGT
CTGCTAAGTGGCAAATTGTGAACTATGATAAAGATGTGAAGTGAAGTGCT
GCAGCGTAAGCGAAGGAAACCAGGAAGTATTGCACCAACTTGCCCCAGTT
TGAATTTATCACCTTAAGTATAAAAGCCGCACAATGAATGCCAGTGAGAA
CTATTTCACGATGGACCCCACAGAGAATATATCCCAGGTCTTAGACCAGA
ACAGAAACAACACAAATAGCCTGCGAACACATCCCACTGTGGAAGAGTAT
TATGAGAACATGACCGCCTTCCTCAGCCTGGCCATCTTCATAGCCAGCCT
GCTGACCATCCTCAACATCAGCATCTTCGCAACGACAGTCTCTCGGCTGC
GTCGTCACCTGGACAAGCCGCTGCTGGGTCCCTCGATTATGATGGTGGGC
CTGTATCCGATTATCTCGGTGGCTGCCCTGGTTACCATTCTGGTGCCGTA
CTCCTGGTTCATCTGCCATACGGTGATGCACGTTATGTTTATGGTCGGCG
GACCTGTCTTCCGCACCCTGCTCTTTCGTTACGTGGGCTCGGAGCAGAAT
TACGTGAAGGAGACGGCCGGCGAGGCGGTGCAACTAAATACTCCTCCGTG
CTGTTGCTGCTGCCTCTGCCTGCCGATGGTGATTCCCACCAAGGCGAAAC
TCTGCATCTCCAGATACATGGTATGGCAAATGCCCTTCTGGCAGGGCTCC
ATTATGCTGGTGATGAACATCCTATACTACCGGGACATTCAGCTCTACCG
GCAGGTCATGTTCTTCTTCATCCCCTTCATCGTCTGCTCCATTGTCTTGG
GCGCTTGGTCCCTCCAAATCACTGTGCGGATGATCACGAAGGTGCGCGGG
GACTATCAGCTGAGAAAGAAGATGTTCTGCCTCCAACTGGTGGTGATGCT
TTGCAAACTGCAGTACCTGGTACTCTATGATCAGCTGGACGGCATCAAAA
TGGGTGGGGAGTATCCCATTAATCACACCGTCTACAAGCAAACTATCATC
AACATCCTTATCCTGGTTGAAATGGTTCTCGTATCCATGATGGTTCAAAG
TGCATATCGTACTCCCGTTCAGGTGCAAATCGATGAGGTTAACAAGGAAA
AGGAAGTTACTCGCATTTGAGTGTGCCTATGAATGTTTAAGCTTGTAGGA
AATAGTAAAATTGTGATAAATTTAATAAAATCATGTTAGCTAAAAAAAAA
AAAAAAAAA

FI07654.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG6836-RA 1355 CG6836-RA 62..1355 1..1294 6470 100 Plus
CG6836.a 1329 CG6836.a 36..1329 1..1294 6470 100 Plus
CG6836.b 1376 CG6836.b 83..1376 1..1294 6470 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18943860..18944277 358..775 2090 100 Plus
chr3L 24539361 chr3L 18943204..18943492 69..357 1445 100 Plus
chr3L 24539361 chr3L 18944814..18945012 1093..1291 995 100 Plus
chr3L 24539361 chr3L 18944530..18944721 901..1092 960 100 Plus
chr3L 24539361 chr3L 18944334..18944465 770..901 660 100 Plus
chr3L 24539361 chr3L 18940280..18940346 2..68 335 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18954254..18954671 358..775 2090 100 Plus
3L 28110227 3L 18953598..18953886 69..357 1445 100 Plus
3L 28110227 3L 18955208..18955409 1093..1294 1010 100 Plus
3L 28110227 3L 18954924..18955115 901..1092 960 100 Plus
3L 28110227 3L 18954728..18954859 770..901 660 100 Plus
3L 28110227 3L 18950647..18950714 1..68 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18947354..18947771 358..775 2090 100 Plus
3L 28103327 3L 18946698..18946986 69..357 1445 100 Plus
3L 28103327 3L 18948308..18948509 1093..1294 1010 100 Plus
3L 28103327 3L 18948024..18948215 901..1092 960 100 Plus
3L 28103327 3L 18947828..18947959 770..901 660 100 Plus
3L 28103327 3L 18943747..18943814 1..68 340 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:38:25 has no hits.

FI07654.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:18 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18944335..18944465 771..901 100 -> Plus
chr3L 18944531..18944721 902..1092 100 -> Plus
chr3L 18944814..18945012 1093..1291 100   Plus
chr3L 18940279..18940346 1..68 98 -> Plus
chr3L 18943204..18943492 69..357 100 -> Plus
chr3L 18943860..18944272 358..770 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:56:33 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 1..987 234..1220 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:52 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 1..987 234..1220 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:40 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 1..987 234..1220 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:01 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 1..987 234..1220 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:47:05 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 1..987 234..1220 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:36:01 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 16..1306 1..1291 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:52 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 16..1306 1..1291 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:40 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 19..1309 1..1291 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:43 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 16..1306 1..1291 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:47:05 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
CG6836-RA 19..1309 1..1291 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:18 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18954925..18955115 902..1092 100 -> Plus
3L 18954254..18954666 358..770 100 -> Plus
3L 18954729..18954859 771..901 100 -> Plus
3L 18950647..18950714 1..68 100 -> Plus
3L 18953598..18953886 69..357 100 -> Plus
3L 18955208..18955406 1093..1291 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:18 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18954925..18955115 902..1092 100 -> Plus
3L 18954254..18954666 358..770 100 -> Plus
3L 18954729..18954859 771..901 100 -> Plus
3L 18950647..18950714 1..68 100 -> Plus
3L 18953598..18953886 69..357 100 -> Plus
3L 18955208..18955406 1093..1291 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:18 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18954925..18955115 902..1092 100 -> Plus
3L 18954254..18954666 358..770 100 -> Plus
3L 18954729..18954859 771..901 100 -> Plus
3L 18950647..18950714 1..68 100 -> Plus
3L 18953598..18953886 69..357 100 -> Plus
3L 18955208..18955406 1093..1291 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:40 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18947829..18947959 771..901 100 -> Plus
arm_3L 18948025..18948215 902..1092 100 -> Plus
arm_3L 18948308..18948506 1093..1291 100   Plus
arm_3L 18943747..18943814 1..68 100 -> Plus
arm_3L 18946698..18946986 69..357 100 -> Plus
arm_3L 18947354..18947766 358..770 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:31 Download gff for FI07654.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18947354..18947766 358..770 100 -> Plus
3L 18947829..18947959 771..901 100 -> Plus
3L 18948025..18948215 902..1092 100 -> Plus
3L 18948308..18948506 1093..1291 100   Plus
3L 18946698..18946986 69..357 100 -> Plus
3L 18943747..18943814 1..68 100 -> Plus

FI07654.pep Sequence

Translation from 233 to 1219

> FI07654.pep
MNASENYFTMDPTENISQVLDQNRNNTNSLRTHPTVEEYYENMTAFLSLA
IFIASLLTILNISIFATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALV
TILVPYSWFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQ
LNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYR
DIQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCL
QLVVMLCKLQYLVLYDQLDGIKMGGEYPINHTVYKQTIINILILVEMVLV
SMMVQSAYRTPVQVQIDEVNKEKEVTRI*

FI07654.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23655-PA 328 GF23655-PA 1..328 1..328 1389 86.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16017-PA 328 GG16017-PA 1..328 1..328 1607 95.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14607-PA 325 GH14607-PA 27..325 24..322 1232 79.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG6836-PA 328 CG6836-PA 1..328 1..328 1708 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:55:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13493-PA 325 GI13493-PA 28..325 25..322 1260 81.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21723-PA 333 GL21723-PA 1..333 1..328 1410 83.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:55:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19894-PA 333 GA19894-PA 1..333 1..328 1410 83.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15006-PA 328 GM15006-PA 1..328 1..328 1727 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14784-PA 328 GD14784-PA 1..328 1..328 1722 98.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11854-PA 325 GJ11854-PA 23..325 20..322 1296 83.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10391-PA 330 GK10391-PA 1..330 1..328 1356 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:55:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19582-PA 328 GE19582-PA 1..328 1..328 1572 94.8 Plus

FI07654.hyp Sequence

Translation from 233 to 1219

> FI07654.hyp
MNASENYFTMDPTENISQVLDQNRNNTNSLRTHPTVEEYYENMTAFLSLA
IFIASLLTILNISIFATTVSRLRRHLDKPLLGPSIMMVGLYPIISVAALV
TILVPYSWFICHTVMHVMFMVGGPVFRTLLFRYVGSEQNYVKETAGEAVQ
LNTPPCCCCCLCLPMVIPTKAKLCISRYMVWQMPFWQGSIMLVMNILYYR
DIQLYRQVMFFFIPFIVCSIVLGAWSLQITVRMITKVRGDYQLRKKMFCL
QLVVMLCKLQYLVLYDQLDGIKMGGEYPINHTVYKQTIINILILVEMVLV
SMMVQSAYRTPVQVQIDEVNKEKEVTRI*

FI07654.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG6836-PA 328 CG6836-PA 1..328 1..328 1708 100 Plus