Clone FI07724 Report

Search the DGRC for FI07724

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:77
Well:24
Vector:pOT2
Associated Gene/TranscriptPGRP-SC1a-RA
Protein status:FI07724.pep: gold
Sequenced Size:651

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
PGRP-SC1b 2008-08-15 Release 5.9 accounting
PGRP-SC1b 2008-12-18 5.12 accounting

Clone Sequence Records

FI07724.complete Sequence

651 bp assembled on 2008-07-25

GenBank Submission: BT044352.1

> FI07724.complete
CAGCGATCGTCAACTATTACAGCTGGTAATCATGGTTTCCAAAGTGGCTC
TCCTCCTCGCCGTCCTGGTCTGCAGCCAGTATATGGCCCAGGGCGTCTAT
GTCGTCTCCAAGGCGGAGTGGGGTGGTCGCGGCGCCAAATGGACCGTAGG
CCTGGGCAACTACCTCAGCTACGCCATCATCCACCACACCGCCGGCTCCT
ACTGCGAGACCCGTGCCCAGTGCAACGCCGTGCTGCAGAGCGTCCAGAAC
TACCACATGGACTCCCTGGGCTGGCCCGACATCGGCTACAACTTCCTGAT
CGGCGGAGACGGCAACGTGTACGAGGGGCGTGGCTGGAACAACATGGGCG
CCCACGCCGCCGAGTGGAACCCCTACAGCATCGGCATCAGCTTCCTGGGC
AACTACAACTGGGACACCCTGGAGCCGAACATGATCTCCGCCGCCCAGCA
GCTGCTCAACGACGCCGTCAACCGTGGCCAGCTCAGCTCCGGCTACATCC
TGTACGGTCATCGCCAGGTCAGCGCCACCGAATGCCCCGGCACTCACATC
TGGAACGAGATCCGCGGCTGGTCCCACTGGTCTGGTTAGAGTGGTTCCTG
AAAAGGTTATAAAATAGTTTGAATGATAAAAAAAAAAAAAAAAAAAAAAA
A

FI07724.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:16
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SC1b-RA 639 PGRP-SC1b-RA 3..629 2..628 3135 100 Plus
PGRP-SC1a-RA 558 PGRP-SC1a-RA 1..558 32..589 2745 99.4 Plus
PGRP-SC2-RA 555 PGRP-SC2-RA 198..374 232..408 510 85.8 Plus
PGRP-SC2-RA 555 PGRP-SC2-RA 399..546 433..580 320 81 Plus
PGRP-SC2-RA 555 PGRP-SC2-RA 118..171 152..205 150 85.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4601025..4601650 2..627 3130 100 Plus
chr2R 21145070 chr2R 4597312..4597899 2..589 2895 99.5 Plus
chr2R 21145070 chr2R 4604663..4605091 152..580 795 79 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8713446..8714072 2..628 3135 100 Plus
2R 25286936 2R 8709733..8710320 2..589 2895 99.5 Plus
2R 25286936 2R 8717084..8717512 152..580 780 78.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8714645..8715271 2..628 3135 100 Plus
2R 25260384 2R 8710932..8711519 2..589 2895 99.4 Plus
2R 25260384 2R 8718363..8718539 232..408 510 85.8 Plus
2R 25260384 2R 8718564..8718711 433..580 320 81 Plus
2R 25260384 2R 8718283..8718336 152..205 150 85.1 Plus
Blast to na_te.dros performed 2019-03-16 09:45:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2385..2536 277..426 107 54.2 Plus

FI07724.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:46:42 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4601023..4601650 1..627 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:56:41 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..558 32..589 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:02 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..558 32..589 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:05:11 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..558 32..589 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:04 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..558 32..589 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:32 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..558 32..589 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:29 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..628 1..627 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:02 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..628 1..627 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:05:11 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..626 2..627 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:45:55 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..628 1..627 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:32 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SC1b-RA 1..626 2..627 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:42 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8713444..8714071 1..627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:42 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8713444..8714071 1..627 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:46:42 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8713444..8714071 1..627 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:05:11 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4600949..4601576 1..627 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:00 Download gff for FI07724.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8714643..8715270 1..627 99   Plus

FI07724.hyp Sequence

Translation from 0 to 611

> FI07724.hyp
KRSSTITAGNHGFQSGSPPRRPGLQPVYGPGRLCRLQGGVGWSRRQMDRR
PGQLPQLRHHPPHRRLLLRDPCPVQRRAAERPELPHGLPGLARHRLQLPD
RRRRQRVRGAWLEQHGRPRRRVEPLQHRHQLPGQLQLGHPGAEHDLRRPA
AAQRRRQPWPAQLRLHPVRSSPGQRHRMPRHSHLERDPRLVPLVWLEWFL
KRL*
Sequence FI07724.hyp has no blast hits.

FI07724.pep Sequence

Translation from 31 to 588

> FI07724.pep
MVSKVALLLAVLVCSQYMAQGVYVVSKAEWGGRGAKWTVGLGNYLSYAII
HHTAGSYCETRAQCNAVLQSVQNYHMDSLGWPDIGYNFLIGGDGNVYEGR
GWNNMGAHAAEWNPYSIGISFLGNYNWDTLEPNMISAAQQLLNDAVNRGQ
LSSGYILYGHRQVSATECPGTHIWNEIRGWSHWSG*

FI07724.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12377-PA 185 GF12377-PA 1..184 1..184 930 94 Plus
Dana\GF21644-PA 185 GF21644-PA 1..184 1..184 930 94 Plus
Dana\GF21643-PA 185 GF21643-PA 1..184 1..184 930 94 Plus
Dana\GF19796-PA 110 GF19796-PA 1..108 76..183 437 75.9 Plus
Dana\GF10506-PA 187 GF10506-PA 1..184 2..183 357 36.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23380-PA 185 GG23380-PA 1..185 1..185 950 96.8 Plus
Dere\GG23379-PA 185 GG23379-PA 1..184 1..184 949 97.3 Plus
Dere\GG23381-PA 184 GG23381-PA 1..182 1..183 660 67.2 Plus
Dere\GG15356-PA 501 GG15356-PA 334..497 22..184 399 45.7 Plus
Dere\GG15854-PA 190 GG15854-PA 5..187 3..183 367 37.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:54:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21354-PA 184 GH21354-PA 1..182 1..183 638 66.1 Plus
Dgri\GH20540-PA 184 GH20540-PA 1..183 1..184 636 64.1 Plus
Dgri\GH21355-PA 184 GH21355-PA 1..183 1..184 631 64.1 Plus
Dgri\GH15225-PA 191 GH15225-PA 3..189 2..184 361 36.4 Plus
Dgri\GH15357-PA 218 GH15357-PA 36..197 24..184 361 41.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:42
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SC1b-PB 185 CG8577-PB 1..185 1..185 1023 100 Plus
PGRP-SC1b-PA 185 CG8577-PA 1..185 1..185 1023 100 Plus
PGRP-SC1a-PA 185 CG14746-PA 1..185 1..185 1023 100 Plus
PGRP-SC2-PA 184 CG14745-PA 1..182 1..183 692 68.9 Plus
PGRP-LC-PE 329 CG4432-PE 165..326 24..184 408 47.5 Plus
PGRP-LC-PD 500 CG4432-PD 336..497 24..184 408 47.5 Plus
PGRP-LC-PA 500 CG4432-PA 336..497 24..184 408 47.5 Plus
PGRP-SB1-PA 190 CG9681-PA 7..187 2..183 369 38.8 Plus
PGRP-LB-PC 232 CG14704-PC 7..193 7..184 330 36.4 Plus
PGRP-SD-PA 186 CG7496-PA 20..183 22..184 327 40.9 Plus
PGRP-SA-PB 203 CG11709-PB 43..199 27..183 323 40.1 Plus
PGRP-SA-PA 203 CG11709-PA 43..199 27..183 323 40.1 Plus
PGRP-LB-PF 215 CG14704-PF 15..176 24..184 323 38.3 Plus
PGRP-LB-PE 215 CG14704-PE 15..176 24..184 323 38.3 Plus
PGRP-LB-PA 215 CG14704-PA 15..176 24..184 323 38.3 Plus
PGRP-LB-PB 215 CG14704-PB 15..176 24..184 323 38.3 Plus
PGRP-LB-PD 255 CG14704-PD 55..216 24..184 323 38.3 Plus
PGRP-SB2-PA 182 CG9697-PA 3..178 7..183 320 39.6 Plus
PGRP-LC-PJ 340 CG4432-PJ 166..326 24..183 316 39.1 Plus
PGRP-LC-PC 511 CG4432-PC 337..497 24..183 316 39.1 Plus
PGRP-LF-PA 369 CG4437-PA 55..220 20..184 314 36.4 Plus
PGRP-LE-PB 345 CG8995-PB 199..337 45..183 299 40.3 Plus
PGRP-LE-PA 345 CG8995-PA 199..337 45..183 299 40.3 Plus
PGRP-LA-PF 299 CG32042-PF 108..275 18..185 215 28.5 Plus
PGRP-LC-PK 330 CG4432-PK 195..330 53..184 215 36 Plus
PGRP-LA-PE 368 CG32042-PE 177..344 18..185 215 28.5 Plus
PGRP-LC-PI 501 CG4432-PI 366..501 53..184 215 36 Plus
PGRP-LC-PH 520 CG4432-PH 385..520 53..184 215 36 Plus
PGRP-LC-PB 520 CG4432-PB 385..520 53..184 215 36 Plus
PGRP-SB2-PB 191 CG9697-PB 3..120 7..125 198 39.5 Plus
PGRP-LA-PG 138 CG32042-PG 1..114 68..185 182 31.4 Plus
PGRP-LA-PC 138 CG32042-PC 1..114 68..185 182 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18808-PA 187 GI18808-PA 1..185 1..183 806 81.6 Plus
Dmoj\GI18809-PA 184 GI18809-PA 1..182 1..183 640 66.7 Plus
Dmoj\GI20770-PA 184 GI20770-PA 1..182 1..183 612 63.4 Plus
Dmoj\GI12108-PA 507 GI12108-PA 317..502 5..184 385 44.1 Plus
Dmoj\GI11935-PA 191 GI11935-PA 1..189 1..184 365 36.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17120-PA 185 GL17120-PA 1..185 1..185 912 91.9 Plus
Dper\GL17117-PA 185 GL17117-PA 1..185 1..185 912 91.9 Plus
Dper\GL18427-PA 462 GL18427-PA 294..459 21..184 385 47 Plus
Dper\GL18428-PA 180 GL18428-PA 1..179 8..184 347 40.3 Plus
Dper\GL12268-PA 310 GL12268-PA 92..279 7..183 341 36.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24974-PA 185 GA24974-PA 1..185 1..185 912 91.9 Plus
Dpse\GA21174-PA 185 GA21174-PA 1..185 1..185 912 91.9 Plus
Dpse\GA13217-PA 184 GA13217-PA 1..182 1..183 649 66.1 Plus
Dpse\GA29295-PA 508 GA29295-PA 340..505 21..184 383 46.4 Plus
Dpse\GA21961-PA 188 GA21961-PA 3..185 2..183 352 36.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21059-PA 185 GM21059-PA 1..185 1..185 974 100 Plus
Dsec\GM21060-PA 185 GM21060-PA 1..185 1..185 966 98.9 Plus
Dsec\GM21061-PA 181 GM21061-PA 1..169 1..170 589 65.9 Plus
Dsec\GM25129-PA 500 GM25129-PA 334..497 22..184 399 46.3 Plus
Dsec\GM24370-PA 190 GM24370-PA 14..187 11..183 372 39.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10589-PA 185 GD10589-PA 1..185 1..185 974 100 Plus
Dsim\PGRP-SC1a-PA 185 GD10593-PA 1..185 1..185 970 99.5 Plus
Dsim\PGRP-SC1b-PA 185 GD10594-PA 1..185 1..185 969 99.5 Plus
Dsim\PGRP-SC2-PA 184 GD10595-PA 1..182 1..183 665 68.3 Plus
Dsim\GD10824-PA 139 GD10824-PA 12..139 58..185 657 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21835-PA 187 GJ21835-PA 1..186 1..184 803 81.2 Plus
Dvir\GJ20505-PA 184 GJ20505-PA 1..182 1..183 648 67.8 Plus
Dvir\GJ21836-PA 184 GJ21836-PA 1..182 1..183 644 65 Plus
Dvir\GJ13383-PA 534 GJ13383-PA 355..528 12..184 366 43.1 Plus
Dvir\GJ12160-PA 191 GJ12160-PA 24..189 20..184 354 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21567-PA 187 GK21567-PA 1..186 1..184 863 87.1 Plus
Dwil\GK21737-PA 185 GK21737-PA 1..183 1..183 642 67.4 Plus
Dwil\GK11791-PA 212 GK11791-PA 1..193 1..184 364 38.9 Plus
Dwil\GK17343-PA 192 GK17343-PA 10..189 6..183 354 37.8 Plus
Dwil\GK23822-PA 541 GK23822-PA 55..220 20..184 351 39.8 Plus
Dwil\GK23822-PA 541 GK23822-PA 377..540 24..184 240 29.3 Plus
Dwil\GK23822-PA 541 GK23822-PA 271..316 58..103 145 52.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:55:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19222-PA 185 GE19222-PA 1..185 1..185 970 99.5 Plus
Dyak\GE19221-PA 185 GE19221-PA 1..185 1..185 964 98.9 Plus
Dyak\GE19223-PA 184 GE19223-PA 1..182 1..183 668 68.3 Plus
Dyak\GE20818-PA 500 GE20818-PA 329..497 18..184 388 45 Plus
Dyak\GE22193-PA 190 GE22193-PA 7..187 5..183 367 37 Plus