Clone FI07764 Report

Search the DGRC for FI07764

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:77
Well:64
Vector:pOT2
Associated Gene/TranscriptCG10635-RA
Protein status:FI07764.pep: gold
Sequenced Size:564

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10635 2008-08-15 Release 5.9 accounting
CG10635 2008-12-18 5.12 accounting

Clone Sequence Records

FI07764.complete Sequence

564 bp assembled on 2008-07-25

GenBank Submission: BT032662

> FI07764.complete
AAAACAGCAACTGTTTGTAAAATATCATAAATTATTTATTAAATTAATTA
AAACCAACGGGAAAATGGCAGCAAAAGTAGCGAGCGGCACGAACAAAGTG
TTCCAGAACCACGATGACGTGCACATCTCCTTCGAGGATCAGCAGCGGAT
CAACCGCTTTGCGAAGCACAACGCCCGCATGGATGACTTCAAAGCGGAGC
TGGAAACGAAGCGCAATGAGCTGAAGAGCTTGGAGGAGGCGCTGGAGGAG
ATTGAGCTGTTCGACGAGGACGAGGACATACCGTTCCTGGTTGGCGAGGT
GTTCCTCTCGCACAAGCTGGAGAAAACACAGGACATGCTGAAGGAGACCA
AGGAGCAGGTGCTCAAGGAGATCGCCGGCGTGGAAGCCAAGGCGAAGGTT
ATCAAGGCGGAAATGGACGAGCTGAAGGCTCATCTGTATCAGCGATTCGG
CAGCAATATCTCACTAGAGGCCGAGGATTAATCCACCATTCATTGATCAA
TTGTTAATTTAACATTTTACAAAATAGAGTACATTTAATTTAAACTCAAA
AAAAAAAAAAAAAA

FI07764.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG10635-RA 772 CG10635-RA 51..595 1..549 2585 98.3 Plus
membrin-RA 879 membrin-RA 839..879 549..509 205 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5359930..5360363 547..110 2020 97.9 Minus
chr3L 24539361 chr3L 5360489..5360597 109..1 545 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:54:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5367339..5367774 549..110 2030 98 Minus
3L 28110227 3L 5367900..5368008 109..1 545 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5360439..5360874 549..110 2040 97.9 Minus
3L 28103327 3L 5361000..5361108 109..1 545 100 Minus
Blast to na_te.dros performed 2019-03-16 16:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
jockey2 3428 jockey2 JOCKEY2 3428bp 3384..3424 18..57 112 78 Plus

FI07764.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:55:52 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5359930..5360363 110..547 98 <- Minus
chr3L 5360489..5360597 1..109 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:56:50 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..417 65..481 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:44 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..417 65..481 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:25 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..417 65..481 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:51:33 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..417 65..481 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:15 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..417 65..481 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:03 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..543 1..547 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:44 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..543 1..547 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:25 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..543 1..547 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:17 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..543 1..547 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:15 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
CG10635-RA 1..543 1..547 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:52 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5367341..5367774 110..547 98 <- Minus
3L 5367900..5368008 1..109 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:52 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5367341..5367774 110..547 98 <- Minus
3L 5367900..5368008 1..109 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:52 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5367341..5367774 110..547 98 <- Minus
3L 5367900..5368008 1..109 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:25 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5360441..5360874 110..547 98 <- Minus
arm_3L 5361000..5361108 1..109 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:34 Download gff for FI07764.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5360441..5360874 110..547 98 <- Minus
3L 5361000..5361108 1..109 100   Minus

FI07764.pep Sequence

Translation from 1 to 480

> FI07764.pep
KQQLFVKYHKLFIKLIKTNGKMAAKVASGTNKVFQNHDDVHISFEDQQRI
NRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDEDIPFLVGEV
FLSHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFG
SNISLEAED*

FI07764.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10465-PA 138 GF10465-PA 1..138 22..159 624 87.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14134-PA 138 GG14134-PA 1..138 22..159 673 94.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15267-PA 138 GH15267-PA 1..138 22..159 614 85.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:35
Subject Length Description Subject Range Query Range Score Percent Strand
Pfdn4-PA 138 CG10635-PA 1..138 22..159 691 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11976-PA 136 GI11976-PA 1..135 22..156 592 83.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12137-PA 138 GL12137-PA 1..138 22..159 595 82.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:40:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10456-PA 138 GA10456-PA 1..138 22..159 595 82.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13921-PA 138 GM13921-PA 1..138 22..159 693 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13201-PA 124 GD13201-PA 1..124 22..159 597 88.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12201-PA 138 GJ12201-PA 1..138 22..159 527 81.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17318-PA 138 GK17318-PA 1..138 22..159 602 84.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:40:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20563-PA 138 GE20563-PA 1..138 22..159 682 96.4 Plus

FI07764.hyp Sequence

Translation from 1 to 480

> FI07764.hyp
KQQLFVKYHKLFIKLIKTNGKMAAKVASGTNKVFQNHDDVHISFEDQQRI
NRFAKHNARMDDFKAELETKRNELKSLEEALEEIELFDEDEDIPFLVGEV
FLSHKLEKTQDMLKETKEQVLKEIAGVEAKAKVIKAEMDELKAHLYQRFG
SNISLEAED*

FI07764.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG10635-PA 138 CG10635-PA 1..138 22..159 691 100 Plus