Clone FI08002 Report

Search the DGRC for FI08002

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:2
Vector:pOTB7
Associated Gene/TranscriptCG5906-RA
Protein status:FI08002.pep: gold
Sequenced Size:881

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5906 2008-08-15 Release 5.9 accounting
CG5906 2008-12-18 5.12 accounting

Clone Sequence Records

FI08002.complete Sequence

881 bp assembled on 2008-07-29

GenBank Submission: BT032663

> FI08002.complete
GTTTCTTAGAGAAATGTGTCAAGATGATTAGAATAGGGGGAGGCACCACC
AGGAACAGGGGATCCTAGATGGCTCTACGAGTGCTATGGAGGCGAATGAC
GAATGCCATGGACCGGTTTCATCAGATAGCCTTCAGCCCAAAGTATCTCC
TATTTACGAACATCGGGATCTCTGTGGGCCTGAGCATGGTGGGCGATACC
ATGGAGCAGTCCTATGAGCGCCTCATAGGGGAGCTTCCGGATTGGAACCG
AACGCGTACCATTAGGATGGGCATATCCGGGTTGACGGTGGGCCTGGTGT
GCCACTATTGGTACCAACATCTGGACTACTTGTTTCCGAAGCGCACCTAT
AAGGTGGTTGTAGTCAAGATTTTGCTGGACCAGTTCATCTGCTCACCCTT
TTACATCGCCGTATTCTTTCTCACAATGGCCATTCTGGAGGACAATACGT
GGGAGGAGCTGGAGCAGGAGATTAGGGAGAAGGCCTTAGTACTGTACGCT
GCTGAGTGGACCGTGTGGCCATTGGCACAGTTCATCAACTTTCTGCTGAT
CAAGCCGCAGTACAGGGTATTCTATGACAACACCATCAGTTTGGGCTACG
ATATCTATACGTCTCAAGTTAAGTATCGTAAGAAGCCGGAGCCAAAAGAT
AATTCGTAAATGGAGAAAAATATTTGGAATATAGCTCAAATCTAATGGTC
TTAATATGGTTGTCTACTGTTCTGGACTGCCACTGCAAATCATACAATAG
CAGGTCCTGAAAAATGTCATTCCAATGCCTTAGATCCTGGAACTAAAATT
TTGGGTGTCCTTAAATAAAATTCTTCTTTGAAGAAAATCAGCAAAGTAGA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI08002.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG5906-RA 862 CG5906-RA 1..854 1..854 4225 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11861244..11862092 849..1 4215 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11870452..11871305 854..1 4225 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11863552..11864405 854..1 4225 99.6 Minus
Blast to na_te.dros performed on 2019-03-16 09:37:17 has no hits.

FI08002.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:38:02 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11861244..11862092 1..849 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:02 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..591 69..659 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:46 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..591 69..659 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:37:54 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..591 69..659 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:54 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..591 69..659 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:42:28 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..591 69..659 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:33:09 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..849 1..849 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:46 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..849 1..849 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:37:54 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..849 1..849 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:19:37 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..849 1..849 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:42:28 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
CG5906-RA 1..849 1..849 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:38:02 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11870457..11871305 1..849 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:38:02 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11870457..11871305 1..849 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:38:02 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11870457..11871305 1..849 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:37:54 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11863557..11864405 1..849 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:09 Download gff for FI08002.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11863557..11864405 1..849 99   Minus

FI08002.hyp Sequence

Translation from 68 to 658

> FI08002.hyp
MALRVLWRRMTNAMDRFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYE
RLIGELPDWNRTRTIRMGISGLTVGLVCHYWYQHLDYLFPKRTYKVVVVK
ILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVW
PLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKPEPKDNS*

FI08002.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG5906-PA 196 CG5906-PA 1..196 1..196 1041 100 Plus
CG1662-PB 245 CG1662-PB 65..236 17..188 538 57.6 Plus
CG1662-PA 245 CG1662-PA 65..236 17..188 538 57.6 Plus
CG32262-PA 273 CG32262-PA 63..238 16..186 271 35.8 Plus
CG32263-PA 206 CG32263-PA 39..199 25..186 236 35.8 Plus

FI08002.pep Sequence

Translation from 68 to 658

> FI08002.pep
MALRVLWRRMTNAMDRFHQIAFSPKYLLFTNIGISVGLSMVGDTMEQSYE
RLIGELPDWNRTRTIRMGISGLTVGLVCHYWYQHLDYLFPKRTYKVVVVK
ILLDQFICSPFYIAVFFLTMAILEDNTWEELEQEIREKALVLYAAEWTVW
PLAQFINFLLIKPQYRVFYDNTISLGYDIYTSQVKYRKKPEPKDNS*

FI08002.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24503-PA 236 GF24503-PA 36..230 1..195 842 75.9 Plus
Dana\GF19409-PA 254 GF19409-PA 73..247 14..188 528 54.3 Plus
Dana\GF10258-PA 293 GF10258-PA 72..247 16..186 275 36.4 Plus
Dana\GF10257-PA 156 GF10257-PA 1..152 40..186 223 35.5 Plus
Dana\GF20998-PA 194 GF20998-PA 40..190 41..192 170 29.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13873-PA 196 GG13873-PA 1..196 1..196 988 90.8 Plus
Dere\GG17779-PA 245 GG17779-PA 62..236 14..188 540 56 Plus
Dere\GG14245-PA 272 GG14245-PA 72..247 16..186 263 36.4 Plus
Dere\GG14244-PA 202 GG14244-PA 32..200 16..186 250 38 Plus
Dere\GG13550-PA 204 GG13550-PA 73..167 79..175 174 36.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16716-PA 220 GH16716-PA 1..193 1..193 655 65.3 Plus
Dgri\GH24495-PA 245 GH24495-PA 39..221 10..192 551 56.3 Plus
Dgri\GH15047-PA 299 GH15047-PA 75..240 25..186 264 36.7 Plus
Dgri\GH24499-PA 203 GH24499-PA 39..191 41..193 162 26.9 Plus
Dgri\GH22820-PA 193 GH22820-PA 67..172 81..186 146 28.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG5906-PA 196 CG5906-PA 1..196 1..196 1041 100 Plus
CG1662-PB 245 CG1662-PB 65..236 17..188 538 57.6 Plus
CG1662-PA 245 CG1662-PA 65..236 17..188 538 57.6 Plus
CG32262-PA 273 CG32262-PA 63..238 16..186 271 35.8 Plus
CG32263-PA 206 CG32263-PA 39..199 25..186 236 35.8 Plus
CG11077-PA 168 CG11077-PA 11..165 33..184 172 30.6 Plus
CG12355-PE 204 CG12355-PE 73..161 79..169 172 36.3 Plus
CG12355-PB 204 CG12355-PB 73..161 79..169 172 36.3 Plus
CG14777-PF 196 CG14777-PF 39..181 42..185 164 27.6 Plus
CG14777-PC 196 CG14777-PC 39..181 42..185 164 27.6 Plus
CG14777-PE 196 CG14777-PE 39..181 42..185 164 27.6 Plus
CG14777-PD 196 CG14777-PD 39..181 42..185 164 27.6 Plus
CG14777-PB 196 CG14777-PB 39..181 42..185 164 27.6 Plus
CG14778-PA 186 CG14778-PA 33..181 42..191 149 26.7 Plus
plh-PB 193 CG2022-PB 28..180 42..194 142 23.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13797-PA 217 GI13797-PA 1..192 3..194 674 64.6 Plus
Dmoj\GI15250-PA 238 GI15250-PA 44..229 14..196 528 53.2 Plus
Dmoj\GI12806-PA 280 GI12806-PA 83..257 25..196 277 37.1 Plus
Dmoj\GI21659-PA 167 GI21659-PA 10..162 33..182 165 30.3 Plus
Dmoj\GI16042-PA 189 GI16042-PA 17..167 41..191 162 28.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25076-PA 197 GL25076-PA 1..191 1..191 734 67.5 Plus
Dper\GL26921-PA 239 GL26921-PA 53..232 9..188 520 53.3 Plus
Dper\GL20995-PA 209 GL20995-PA 4..176 25..193 262 37.1 Plus
Dper\GL20996-PA 298 GL20996-PA 50..249 1..186 260 33.5 Plus
Dper\GL14256-PA 204 GL14256-PA 42..194 42..195 173 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19218-PA 197 GA19218-PA 1..191 1..191 734 67.5 Plus
Dpse\GA14082-PA 239 GA14082-PA 53..232 9..188 520 53.3 Plus
Dpse\GA16798-PA 180 GA16798-PA 4..179 25..196 267 37.1 Plus
Dpse\GA23490-PA 298 GA23490-PA 50..249 1..186 260 33.5 Plus
Dpse\GA13236-PA 204 GA13236-PA 42..194 42..195 176 29 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24695-PA 196 GM24695-PA 1..196 1..196 1040 97.4 Plus
Dsec\GM11631-PA 245 GM11631-PA 62..236 14..188 541 56 Plus
Dsec\GM14038-PA 282 GM14038-PA 72..247 16..186 260 35.8 Plus
Dsec\GM14037-PA 205 GM14037-PA 40..198 25..186 221 35.2 Plus
Dsec\GM19141-PA 196 GM19141-PA 38..191 41..196 169 27.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17579-PA 196 GD17579-PA 1..196 1..196 1035 96.9 Plus
Dsim\GD17122-PA 245 GD17122-PA 62..236 14..188 541 56 Plus
Dsim\GD13317-PA 282 GD13317-PA 72..247 16..186 260 35.8 Plus
Dsim\GD13316-PA 207 GD13316-PA 40..200 25..186 238 37 Plus
Dsim\GD12563-PA 205 GD12563-PA 74..168 79..175 169 36.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11665-PA 192 GJ11665-PA 1..183 1..183 722 69.4 Plus
Dvir\GJ14822-PA 238 GJ14822-PA 43..221 14..192 536 55.3 Plus
Dvir\GJ12951-PA 285 GJ12951-PA 82..245 25..186 253 35.4 Plus
Dvir\GJ16017-PA 168 GJ16017-PA 10..164 33..184 166 31.8 Plus
Dvir\GJ15554-PA 202 GJ15554-PA 43..188 42..188 165 27.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19153-PA 197 GK19153-PA 1..197 6..195 653 59.4 Plus
Dwil\GK25287-PA 231 GK25287-PA 56..230 14..188 553 57.7 Plus
Dwil\GK20364-PA 309 GK20364-PA 63..243 11..186 283 37 Plus
Dwil\GK19158-PA 178 GK19158-PA 4..164 25..186 248 35.8 Plus
Dwil\GK10054-PA 206 GK10054-PA 43..196 42..196 167 28 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20165-PA 196 GE20165-PA 1..196 1..196 993 90.3 Plus
Dyak\GE17073-PA 246 GE17073-PA 63..237 14..188 542 56 Plus
Dyak\GE20674-PA 272 GE20674-PA 72..247 16..186 263 36.4 Plus
Dyak\GE20673-PA 207 GE20673-PA 40..200 25..186 240 38.9 Plus
Dyak\GE19851-PA 204 GE19851-PA 73..167 79..175 170 36.1 Plus