FI08003.complete Sequence
659 bp assembled on 2008-08-25
GenBank Submission: BT044359.1
> FI08003.complete
CCATTCTATTTCAGCCTTATCACATATCAAAATTTTAAAAATTTTAGGTT
TCCAAAATTTGTAAATTTTATACCCCGATTAGCTAGATTTTTATTCCCTA
AGATGCGGATGCTTTGCGACAGACTCTCCGCCCTGACGGCTGGTGCCATG
GTCGGCGTTTGGTACGCCCAAAACTTCCCCTGCGAAAATCCTACGGATGG
AGGCGACAAAGATAAGGCCAAGGACAAGGCCAAAAGCACGGATAAGGGAA
AAGAGAAGGAGAAGGATAAGGGGAAGGGGAAGGATGGTGGCCAGGACAAG
GGCAAGGAGAAAGGCAAGGAATAGGGATAAGAAAATAGCTAAAAAGGGGT
GGAAAAATCACACCATTTAGACGATACAATACGATACGTATGTGCAAGTC
CTCTTAAACGAATTTCTCCTCTAGTTAGTCCAAAACGTACTAGTAGACAT
GAGCAAAACTCCAACGTCGACGATGCAATTGGCTTGAAAAGGAAAAGTTT
GAAGTAAATGGCCGCTGATAACGCTTCCGAAAGAGCTATGTTTATATGGT
TTTATTATCACATGCTCTGAAGCAGATGTTAACGATTTTGCATTTAAATA
ATTATACGAGAATGCGTATTGTATCATCTTAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA
FI08003.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:07:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12901-RC | 632 | CG12901-RC | 1..632 | 1..632 | 3145 | 99.8 | Plus |
CG12901-RA | 734 | CG12901-RA | 222..734 | 120..632 | 2550 | 99.8 | Plus |
CG12901-RB | 568 | CG12901-RB | 1..397 | 1..397 | 1925 | 98.9 | Plus |
CG12901-RB | 568 | CG12901-RB | 388..568 | 447..627 | 905 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:50:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 6243593..6244222 | 630..1 | 3150 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:50:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 10356168..10356800 | 633..1 | 3150 | 99.8 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:25:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 10357367..10357999 | 633..1 | 3150 | 99.8 | Minus |
Blast to na_te.dros performed 2019-03-16 00:50:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
1360 | 3409 | 1360 1360 3409bp | 3016..3057 | 67..26 | 111 | 73.8 | Minus |
FI08003.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:51:34 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 6243593..6244222 | 1..630 | 92 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:04 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12901-RB | 1..222 | 103..324 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:14 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42733-RB | 1..222 | 103..324 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:41 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42733-RC | 1..222 | 103..324 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:45 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12901-RB | 1..222 | 103..324 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:15:32 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42733-RC | 1..222 | 103..324 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:08:13 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12901-RC | 1..630 | 1..630 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:13 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42733-RC | 1..630 | 1..630 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:41 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42733-RC | 1..630 | 1..630 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-25 10:59:12 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12901-RC | 1..630 | 1..630 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:15:32 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42733-RC | 1..630 | 1..630 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:51:34 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10356171..10356800 | 1..630 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:51:34 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10356171..10356800 | 1..630 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:51:34 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10356171..10356800 | 1..630 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:41 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 6243676..6244305 | 1..630 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:41:27 Download gff for
FI08003.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 10357370..10357999 | 1..630 | 99 | | Minus |
FI08003.pep Sequence
Translation from 0 to 323
> FI08003.pep
PFYFSLITYQNFKNFRFPKFVNFIPRLARFLFPKMRMLCDRLSALTAGAM
VGVWYAQNFPCENPTDGGDKDKAKDKAKSTDKGKEKEKDKGKGKDGGQDK
GKEKGKE*
FI08003.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:25:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG25216-PA | 141 | GG25216-PA | 77..113 | 41..79 | 157 | 82.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42733-PB | 73 | CG12901-PB | 1..73 | 35..107 | 395 | 100 | Plus |
CG42733-PC | 73 | CG12901-PC | 1..73 | 35..107 | 395 | 100 | Plus |
CG42733-PD | 97 | CG42733-PD | 1..70 | 35..104 | 379 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:25:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM20535-PA | 139 | GM20535-PA | 77..139 | 41..107 | 158 | 83.6 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:25:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD25992-PA | 139 | GD25992-PA | 77..139 | 41..107 | 165 | 83.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:25:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21622-PA | 73 | GE21622-PA | 1..36 | 35..70 | 192 | 94.4 | Plus |
FI08003.hyp Sequence
Translation from 0 to 323
> FI08003.hyp
PFYFSLITYQNFKNFRFPKFVNFIPRLARFLFPKMRMLCDRLSALTAGAM
VGVWYAQNFPCENPTDGGDKDKAKDKAKSTDKGKEKEKDKGKGKDGGQDK
GKEKGKE*
FI08003.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:37:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42733-PB | 73 | CG12901-PB | 1..73 | 35..107 | 395 | 100 | Plus |
CG42733-PC | 73 | CG12901-PC | 1..73 | 35..107 | 395 | 100 | Plus |
CG42733-PD | 97 | CG42733-PD | 1..70 | 35..104 | 379 | 100 | Plus |