Clone FI08011 Report

Search the DGRC for FI08011

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:11
Vector:pOTB7
Associated Gene/TranscriptCG3500-RA
Protein status:FI08011.pep: gold
Sequenced Size:971

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3500 2008-08-15 Release 5.9 accounting
CG3500 2008-12-18 5.12 accounting

Clone Sequence Records

FI08011.complete Sequence

971 bp assembled on 2008-07-28

GenBank Submission: BT044362.1

> FI08011.complete
TTTTAAGTCATGGTCCATGGATGCTGCTGCTCACATTAGTTAGTTTGCAT
ATGGATTTCAATCCTAAATTCCTCATGTTTCCCACAAAAAATATTTGAAA
AAGCGTTGGAACGAGAATATCTGGCAGCTCTGCGCATTAGTGTGCCCGTT
TCTATACAAGCTGATTAAATGTGTGGTATTTCGAGCCACACACCACACGC
CACTCTAATCGGATTGTTTTGTTTTGTCGGCCGATTTGAGCCGTATATAT
CCTTCGATTCCGCCTGAAGTACGCAAGATGGCCGTCCTGTACCTGCTGGG
ATGGGTTTCGCTGGCCATACAGATCGTGTTCCTCACCCTGTCGATTGTGG
CTGGTCTCTATTATCTGGCGGAGCTGGCCGAGGAGTACACGACGGCGGCT
AGGAAGTGCATCCTATTTCTGATCAGCTTCACGATCTTCGTCTACATCCT
GCTGCTGCTGTTCGAGGACCTGCCGTGGAGCCTTATCATCTGCGGACTGG
TGGCGCAGGGCTTCCACCTGGGCATCATGAGTGGATTCCCCTTCGTGCGC
CTGCTCTCGCTGCCGCTGCTGGGCTCCCTGGCCATGCTGGTGGTCAATCA
CTTCCTGGCCTTCCAGCATTTCGTCACTGTCTATGTGCCTTTCACGCAGG
TGCTGGCTTATTTTACCATCTGCATGTGGATCGTGCCCTTCGCCCTGTTC
GTCTCGCTGAGTGCGAATGACAGTGTCCTGCCCACCACCGTCAGCGACCA
GAGCCGGCGCAGTCCGGACGTGGTCAGCAACTACTTCTCGCGCAACAAGA
AGCAGGGCCTGCTGTCGCTGTTCCAGTATCTGAAAGAGGCCCTGCTCCCT
GGGCGGACCAAGAAGGCCTTCTAGATCTAGCTTGTTTAATGTTTATTTAT
TTTTGTAGCCGCAATCGAGACAAAAGTATACAAAGCGCATGTGAACTGAA
AAAAAAAAAAAAAAAAAAAAA

FI08011.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG3500-RA 1039 CG3500-RA 22..970 1..949 4700 99.6 Plus
CG3500.a 966 CG3500.a 1..650 1..650 3235 99.8 Plus
CG3500.a 966 CG3500.a 664..966 647..949 1485 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19243533..19243879 347..1 1720 99.7 Minus
chr2R 21145070 chr2R 19243167..19243472 652..347 1530 100 Minus
chr2R 21145070 chr2R 19242686..19242987 948..647 1480 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23357219..23357565 347..1 1720 99.7 Minus
2R 25286936 2R 23356853..23357158 652..347 1530 100 Minus
2R 25286936 2R 23356371..23356673 949..647 1485 99.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23358418..23358764 347..1 1720 99.7 Minus
2R 25260384 2R 23358052..23358357 652..347 1530 100 Minus
2R 25260384 2R 23357570..23357872 949..647 1485 99.3 Minus
Blast to na_te.dros performed on 2019-03-15 21:18:29 has no hits.

FI08011.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:32 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19242686..19242984 650..948 99 <- Minus
chr2R 19243170..19243471 348..649 100 <- Minus
chr2R 19243533..19243879 1..347 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:13 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..597 278..874 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:13 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..597 278..874 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:43:55 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..597 278..874 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:12 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..597 278..874 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:27 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..597 278..874 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:30 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..948 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:13 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..948 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:43:55 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..948 1..948 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:38 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..948 1..948 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:27 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
CG3500-RA 1..948 1..948 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:32 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23356372..23356670 650..948 99 <- Minus
2R 23356856..23357157 348..649 100 <- Minus
2R 23357219..23357565 1..347 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:32 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23356372..23356670 650..948 99 <- Minus
2R 23356856..23357157 348..649 100 <- Minus
2R 23357219..23357565 1..347 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:32 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23356372..23356670 650..948 99 <- Minus
2R 23356856..23357157 348..649 100 <- Minus
2R 23357219..23357565 1..347 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:43:55 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19243895..19244193 650..948 99 <- Minus
arm_2R 19244379..19244680 348..649 100 <- Minus
arm_2R 19244742..19245088 1..347 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:33 Download gff for FI08011.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23357589..23357887 650..948 99 <- Minus
2R 23358073..23358374 348..649 100 <- Minus
2R 23358436..23358782 1..347 99   Minus

FI08011.hyp Sequence

Translation from 277 to 873

> FI08011.hyp
MAVLYLLGWVSLAIQIVFLTLSIVAGLYYLAELAEEYTTAARKCILFLIS
FTIFVYILLLLFEDLPWSLIICGLVAQGFHLGIMSGFPFVRLLSLPLLGS
LAMLVVNHFLAFQHFVTVYVPFTQVLAYFTICMWIVPFALFVSLSANDSV
LPTTVSDQSRRSPDVVSNYFSRNKKQGLLSLFQYLKEALLPGRTKKAF*

FI08011.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG3500-PB 198 CG3500-PB 1..198 1..198 999 100 Plus
CG3500-PA 198 CG3500-PA 1..198 1..198 999 100 Plus

FI08011.pep Sequence

Translation from 277 to 873

> FI08011.pep
MAVLYLLGWVSLAIQIVFLTLSIVAGLYYLAELAEEYTTAARKCILFLIS
FTIFVYILLLLFEDLPWSLIICGLVAQGFHLGIMSGFPFVRLLSLPLLGS
LAMLVVNHFLAFQHFVTVYVPFTQVLAYFTICMWIVPFALFVSLSANDSV
LPTTVSDQSRRSPDVVSNYFSRNKKQGLLSLFQYLKEALLPGRTKKAF*

FI08011.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11634-PA 198 GF11634-PA 1..198 1..198 882 88.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20043-PA 198 GG20043-PA 1..198 1..198 929 95.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23043-PA 202 GH23043-PA 1..202 1..198 786 71.8 Plus
Dgri\GH13920-PA 185 GH13920-PA 7..185 24..198 706 72.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG3500-PB 198 CG3500-PB 1..198 1..198 999 100 Plus
CG3500-PA 198 CG3500-PA 1..198 1..198 999 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21112-PA 202 GI21112-PA 1..202 1..198 809 73.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11276-PA 197 GL11276-PA 1..197 1..198 880 82.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17484-PA 197 GA17484-PA 1..197 1..198 874 81.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15556-PA 198 GM15556-PA 1..198 1..198 990 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25059-PA 184 GD25059-PA 1..159 1..159 715 95.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:17:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20961-PA 202 GJ20961-PA 1..202 1..198 785 71.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19578-PA 198 GK19578-PA 1..198 1..198 815 76.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11578-PA 198 GE11578-PA 1..198 1..198 928 95.5 Plus