Clone FI08014 Report

Search the DGRC for FI08014

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:14
Vector:pOTB7
Associated Gene/TranscriptCG14841-RA
Protein status:FI08014.pep: gold
Sequenced Size:978

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14841 2008-08-15 Release 5.9 accounting
CG14841 2008-12-18 5.12 accounting

Clone Sequence Records

FI08014.complete Sequence

978 bp assembled on 2008-07-28

GenBank Submission: BT032665

> FI08014.complete
AGATGCCATGCCTGTCAAATCCGGAAATCGAGATTATGCTCTATTGCCAG
GCAATGTGCTTATTCCTGCTTAGCCTTGCTTGCGTTTCGCGGAGCCACAT
AATCATGATAAGCGACTCGGATCCTGTTGTGGCTCGATTGTATGAGCCAG
CAAGCGAAAAGAAGCAGACTGCAAGTGGAGGATCATCGGAAGGGTGTGAA
ACAAGTTCTGCTGTGCAAAATTCTTGTGGCCTTAGCCAAAAGAATGCCAA
GAGCAAGGCTTCCAGCATTGCAATTAAGGCCGCCCAGGACGCCAAGGCGG
CCAATGACGCCCAGATGGCCGCCGGAGAGGCAGCCTCACTCCAAGTGAAA
CAGGATCTGGCCGAGAAGGCGGTCCAAGCTGCTCGAGCCGCGGAGGCAGC
TCTTGCTGGCAAGCAACAGATCATGGAGCAACTGGAGCTGGAGGAAAAGG
AGGCGGTGGCCGTTGTGGACGAGGTTAAGAACTCACTCCACAGCACACAG
GTGAACGCAGAATCTGCCATGTTAGCGTTTTCCGAAGCCAAGATTCAGCT
GGACCAACTGAAAGTCCTTTTGGCTGAGGCCACCGCTCAAATGACCAACA
TTGAAACTTTCGCTAATGGTGCCCAATTGGAGATGGATGAGAAGGGGCAG
CTGTTGGAGGCGGCCAATCGGAGAGTGGAGAGCATCTCCAGACAAGTGGT
CGCTGCCAGGCAGGATTACGACAAGACCAAGAAGGCTGCCTATAAGGCGG
CTTGTGCGGCAGTGGAGGCCAAGCAAAAGGCTCAAAGGATGCAAAGGGCG
ATTAGCTCTGCATCCTCTTCAAGCTAGAAACGATCAATATTAGCCATTAT
CATTTAAATTTTATACATATATATATATTTTTGTAAAGTTTATAATGCTA
CTTTTTTAAAAATAATATATTATATCAATATAATAAAAAATATACTGCGA
GCATGTAAAAAAAAAAAAAAAAAAAAAA

FI08014.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG14841-RA 956 CG14841-RA 1..956 1..956 4765 99.8 Plus
CG14840-RA 1006 CG14840-RA 753..822 719..788 200 85.7 Plus
CG14840-RA 1006 CG14840-RA 289..477 255..443 195 73.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10086212..10087049 956..119 4175 99.9 Minus
chr3R 27901430 chr3R 10087120..10087239 120..1 585 99.2 Minus
chr3R 27901430 chr3R 10085213..10085282 788..719 200 85.7 Minus
chr3R 27901430 chr3R 10085558..10085746 443..255 195 73.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14261389..14262228 958..119 4185 99.9 Minus
3R 32079331 3R 14262299..14262418 120..1 600 100 Minus
3R 32079331 3R 14260392..14260461 788..719 200 85.7 Minus
3R 32079331 3R 14260737..14260925 443..255 195 73.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14002220..14003059 958..119 4185 99.8 Minus
3R 31820162 3R 14003130..14003249 120..1 600 100 Minus
3R 31820162 3R 14001223..14001292 788..719 200 85.7 Minus
3R 31820162 3R 14001568..14001756 443..255 195 73.5 Minus
Blast to na_te.dros performed on 2019-03-16 18:36:35 has no hits.

FI08014.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:37:16 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10086212..10087048 120..956 99 <- Minus
chr3R 10087121..10087239 1..119 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:14 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..825 3..827 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:39 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..825 3..827 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:19 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..825 3..827 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:09 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..825 3..827 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:43:57 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..825 3..827 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:23:31 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..956 1..956 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:39 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..956 1..956 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:19 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..956 1..956 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:22:06 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..956 1..956 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:43:57 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
CG14841-RA 1..956 1..956 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:37:16 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14261391..14262227 120..956 99 <- Minus
3R 14262300..14262418 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:37:16 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14261391..14262227 120..956 99 <- Minus
3R 14262300..14262418 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:37:16 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14261391..14262227 120..956 99 <- Minus
3R 14262300..14262418 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:19 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10087113..10087949 120..956 99 <- Minus
arm_3R 10088022..10088140 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:48 Download gff for FI08014.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14002222..14003058 120..956 99 <- Minus
3R 14003131..14003249 1..119 100   Minus

FI08014.hyp Sequence

Translation from 2 to 826

> FI08014.hyp
MPCLSNPEIEIMLYCQAMCLFLLSLACVSRSHIIMISDSDPVVARLYEPA
SEKKQTASGGSSEGCETSSAVQNSCGLSQKNAKSKASSIAIKAAQDAKAA
NDAQMAAGEAASLQVKQDLAEKAVQAARAAEAALAGKQQIMEQLELEEKE
AVAVVDEVKNSLHSTQVNAESAMLAFSEAKIQLDQLKVLLAEATAQMTNI
ETFANGAQLEMDEKGQLLEAANRRVESISRQVVAARQDYDKTKKAAYKAA
CAAVEAKQKAQRMQRAISSASSSS*

FI08014.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG14841-PA 274 CG14841-PA 1..274 1..274 1317 100 Plus
CG14840-PA 300 CG14840-PA 55..267 59..265 559 59.6 Plus
CG34459-PC 305 CG34459-PC 75..295 57..260 473 48.9 Plus
CG34459-PB 305 CG34459-PB 75..295 57..260 473 48.9 Plus
CG34459-PA 305 CG34459-PA 75..295 57..260 473 48.9 Plus

FI08014.pep Sequence

Translation from 2 to 826

> FI08014.pep
MPCLSNPEIEIMLYCQAMCLFLLSLACVSRSHIIMISDSDPVVARLYEPA
SEKKQTASGGSSEGCETSSAVQNSCGLSQKNAKSKASSIAIKAAQDAKAA
NDAQMAAGEAASLQVKQDLAEKAVQAARAAEAALAGKQQIMEQLELEEKE
AVAVVDEVKNSLHSTQVNAESAMLAFSEAKIQLDQLKVLLAEATAQMTNI
ETFANGAQLEMDEKGQLLEAANRRVESISRQVVAARQDYDKTKKAAYKAA
CAAVEAKQKAQRMQRAISSASSSS*

FI08014.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23178-PA 296 GF23178-PA 14..282 12..266 456 57.2 Plus
Dana\GF23179-PA 289 GF23179-PA 60..265 60..265 288 59.7 Plus
Dana\GF11413-PA 470 GF11413-PA 146..306 114..274 255 48.4 Plus
Dana\GF16670-PA 204 GF16670-PA 6..166 83..243 227 53.4 Plus
Dana\GF23051-PA 286 GF23051-PA 7..259 12..259 214 37.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21383-PA 244 GG21383-PA 1..236 35..271 751 78.7 Plus
Dere\GG20633-PA 462 GG20633-PA 54..286 37..260 320 46.6 Plus
Dere\GG21391-PA 298 GG21391-PA 81..265 81..265 293 64.3 Plus
Dere\GG17458-PA 259 GG17458-PA 50..243 73..265 224 50.5 Plus
Dere\GG11426-PA 286 GG11426-PA 50..239 77..266 213 48.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:46:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19677-PA 263 GH19677-PA 1..257 12..265 347 52.1 Plus
Dgri\GH19676-PA 252 GH19676-PA 1..252 12..267 324 51.3 Plus
Dgri\GH19678-PA 273 GH19678-PA 45..250 57..265 301 59.8 Plus
Dgri\GH17423-PA 238 GH17423-PA 39..225 81..267 261 54 Plus
Dgri\GH19706-PA 199 GH19706-PA 6..199 72..265 241 43.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG14841-PA 274 CG14841-PA 1..274 1..274 1317 100 Plus
CG14840-PA 300 CG14840-PA 55..267 59..265 559 59.6 Plus
CG34459-PC 305 CG34459-PC 75..295 57..260 473 48.9 Plus
CG34459-PB 305 CG34459-PB 75..295 57..260 473 48.9 Plus
CG34459-PA 305 CG34459-PA 75..295 57..260 473 48.9 Plus
CG14354-PA 298 CG14354-PA 16..245 32..266 427 44.3 Plus
CG11694-PA 261 CG11694-PA 39..245 60..265 412 47.8 Plus
CG12985-PA 370 CG12985-PA 117..295 81..259 353 41.3 Plus
CG14839-PA 282 CG14839-PA 51..261 59..264 316 40.3 Plus
CG11698-PA 262 CG11698-PA 50..233 85..268 300 37.5 Plus
CG33257-PA 330 CG33257-PA 59..270 48..262 199 28.4 Plus
CG11693-PA 318 CG11693-PA 71..283 47..260 195 30.8 Plus
CG11693-PB 323 CG11693-PB 76..288 47..260 195 30.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24533-PA 270 GI24533-PA 1..252 12..265 411 50.6 Plus
Dmoj\GI20828-PA 301 GI20828-PA 101..294 81..268 372 53.6 Plus
Dmoj\GI24535-PA 266 GI24535-PA 27..248 48..268 349 57.5 Plus
Dmoj\GI24534-PA 266 GI24534-PA 7..265 20..274 345 52.3 Plus
Dmoj\GI22752-PA 265 GI22752-PA 39..251 46..265 291 49.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23292-PA 280 GL23292-PA 1..258 12..265 337 50.6 Plus
Dper\GL17739-PA 409 GL17739-PA 117..296 81..260 307 54.4 Plus
Dper\GL23291-PA 219 GL23291-PA 1..209 12..214 284 47.9 Plus
Dper\GL24119-PA 264 GL24119-PA 65..239 82..256 249 52 Plus
Dper\GL24243-PA 262 GL24243-PA 46..240 58..259 231 39.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13287-PA 278 GA13287-PA 1..262 12..267 383 50.4 Plus
Dpse\GA27211-PA 280 GA27211-PA 66..258 75..265 317 61.1 Plus
Dpse\GA27677-PA 402 GA27677-PA 113..301 81..269 308 52.9 Plus
Dpse\GA11146-PB 267 GA11146-PB 68..253 82..267 281 51.6 Plus
Dpse\GA13285-PA 246 GA13285-PA 46..224 81..259 235 45.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25863-PA 265 GM25863-PA 1..264 1..264 1060 88.3 Plus
Dsec\GM21727-PA 455 GM21727-PA 63..279 57..260 330 48.8 Plus
Dsec\GM25864-PA 302 GM25864-PA 71..267 64..265 322 59.9 Plus
Dsec\GM10266-PA 296 GM10266-PA 9..245 18..266 227 42.6 Plus
Dsec\GM26352-PA 261 GM26352-PA 62..223 82..243 206 51.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20434-PA 264 GD20434-PA 1..263 1..264 1036 86.7 Plus
Dsim\GD11222-PA 470 GD11222-PA 86..294 49..260 340 49.1 Plus
Dsim\GD20435-PA 302 GD20435-PA 71..267 64..265 318 59.4 Plus
Dsim\GD21236-PA 296 GD21236-PA 9..245 18..266 226 42.6 Plus
Dsim\GD17372-PA 360 GD17372-PA 106..292 73..259 171 41.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20562-PA 352 GJ20562-PA 65..248 77..260 378 55.4 Plus
Dvir\GJ22600-PA 262 GJ22600-PA 1..258 12..265 342 55.1 Plus
Dvir\GJ22601-PA 233 GJ22601-PA 72..232 114..274 317 61.5 Plus
Dvir\GJ22602-PA 271 GJ22602-PA 47..253 58..267 317 63.3 Plus
Dvir\GJ22753-PA 219 GJ22753-PA 23..205 83..265 264 52.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10892-PA 290 GK10892-PA 1..261 12..260 335 55.6 Plus
Dwil\GK22021-PA 418 GK22021-PA 117..296 81..260 317 56.7 Plus
Dwil\GK14387-PA 246 GK14387-PA 42..237 73..266 285 54.1 Plus
Dwil\GK12192-PA 270 GK12192-PA 66..259 72..265 263 45.9 Plus
Dwil\GK11064-PA 264 GK11064-PA 1..226 12..244 231 41.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10039-PA 278 GE10039-PA 1..269 4..270 946 79.9 Plus
Dyak\GE11823-PA 449 GE11823-PA 70..282 58..260 332 47.9 Plus
Dyak\GE10040-PA 301 GE10040-PA 72..268 64..265 311 60.4 Plus
Dyak\GE23621-PA 296 GE23621-PA 59..249 76..266 263 47.6 Plus
Dyak\GE24857-PA 260 GE24857-PA 53..244 75..265 222 51.6 Plus