Clone FI08015 Report

Search the DGRC for FI08015

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:15
Vector:pOTB7
Associated Gene/TranscriptCG30278-RA
Protein status:FI08015.pep: gold
Sequenced Size:948

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30278 2008-08-15 Release 5.9 accounting
CG30278 2008-12-18 5.12 accounting

Clone Sequence Records

FI08015.complete Sequence

948 bp assembled on 2008-07-24

GenBank Submission: BT044363.1

> FI08015.complete
GCTAAATAAACGAGCTTAGAGTAAAGCTTCAATTTATCAGATTATTCCAT
GTCATTTCAAAATTACTCGTTTCCCGGCTAAAAAATTGTACGGCCTTCAA
AATGTCCGCTCCGGAGAACAGTTGTAGGCGGTGGATAAAAAAAAATTGGG
TTGACGGTCCATGCAAGAAGTGCTTCGAATCCACCTGCGGACCATGCATC
GATTACAGGGTATCACCGCCTGCAGCAGACTTGCCTGAGCCCCAGGCGGA
GGTTGTTAAGGCGGTCATTGAACCGGATGGACCTGTGCGTCAGGAGATCA
ACATCCGGGCGGAGTGCAGCAAGGGACGTCCGCTTCTGGAATCCGACAAG
GACAAACTGCGATGCTGTACCATGTGCGTGGCTCAGGAGCAGAATCTGCA
CCCTAATCTCTGCTCGGCGCAATGCCGGCCACTCAAAACCTATTTGCATT
TGAATGAGTGGACAAAGCGACCCCTTCCCAAGCCCACATACAAACATTCT
GTTATCCTGGACAATAACACCATAGTAGGTCGGTGCTTCCCGATGAAATT
CCAGCTGAGACGCACAAAAAAGAATTGCCTGGACTGCGGAAATGAACTTT
ACTACCGGTATCCCATCACAAATAACAGCGATCTGCTGCTGATCAAGAAC
TGCTGCGAAGTGGAGGTCTATCCCGCCAAGAAAGTGGAAAATATGAACAA
CGTGAGGGTGACCAAGATATCGGGAGTCAAGAAGTTCGCCAACAGTCTGC
TGAAGGAGCACTCCGAGTGCCGGCTGTTCACCTTGGCCAGCCAACTTGCG
AAGCAGAAACCACCTTTGGCGCCTGATGTTAGGATGAGTCGGATGAGCAG
GAAGAGCCGGAAGAGCCGAAAGAGCCGGAAGAGCAGCAGAAAGAGTTCAC
TGTTCGGCAATAAAAAGGGTAAAAAATAATAAAAAAAAAAAAAAAAAA

FI08015.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG30278-RA 930 CG30278-RA 1..930 1..930 4470 98.7 Plus
Oatp58Da-RA 2157 Oatp58Da-RA 2114..2157 1..44 220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18104125..18104598 930..457 2355 99.8 Minus
chr2R 21145070 chr2R 18104649..18105106 458..1 2290 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:19:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22217509..22217990 938..457 2290 98.3 Minus
2R 25286936 2R 22218041..22218498 458..1 2200 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22218708..22219189 938..457 2290 98.3 Minus
2R 25260384 2R 22219240..22219697 458..1 2200 98.6 Minus
Blast to na_te.dros performed on 2019-03-16 11:53:12 has no hits.

FI08015.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:53:51 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18104649..18105106 1..458 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:15 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..828 102..929 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:33 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..828 102..929 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:40:57 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..828 102..929 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:03 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..828 102..929 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:58 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..828 102..929 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:42 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..930 1..930 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:32 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..930 1..930 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:40:57 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..930 1..930 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:07 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 1..930 1..930 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:58 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
CG30278-RA 3..932 1..930 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:51 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22217517..22217988 459..930 98 <- Minus
2R 22218041..22218498 1..458 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:51 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22217517..22217988 459..930 98 <- Minus
2R 22218041..22218498 1..458 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:53:51 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22217517..22217988 459..930 98 <- Minus
2R 22218041..22218498 1..458 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:40:57 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18105022..18105493 459..930 98 <- Minus
arm_2R 18105546..18106003 1..458 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:19 Download gff for FI08015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22218716..22219187 459..930 98 <- Minus
2R 22219240..22219697 1..458 98   Minus

FI08015.pep Sequence

Translation from 101 to 928

> FI08015.pep
MSAPENSCRRWIKKNWVDGPCKKCFESTCGPCIDYRVSPPAADLPEPQAE
VVKAVIEPDGPVRQEINIRAECSKGRPLLESDKDKLRCCTMCVAQEQNLH
PNLCSAQCRPLKTYLHLNEWTKRPLPKPTYKHSVILDNNTIVGRCFPMKF
QLRRTKKNCLDCGNELYYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNN
VRVTKISGVKKFANSLLKEHSECRLFTLASQLAKQKPPLAPDVRMSRMSR
KSRKSRKSRKSSRKSSLFGNKKGKK*

FI08015.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:03:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12323-PA 274 GF12323-PA 1..242 1..239 946 74 Plus
Dana\GF12970-PA 220 GF12970-PA 98..218 101..221 162 31.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20708-PA 275 GG20708-PA 1..246 1..245 1208 91.5 Plus
Dere\GG20796-PA 219 GG20796-PA 92..217 96..221 171 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20437-PA 262 GH20437-PA 1..201 1..208 430 44.1 Plus
Dgri\GH21170-PA 223 GH21170-PA 101..221 101..221 150 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG30278-PC 275 CG30278-PC 1..275 1..275 1487 100 Plus
CG30278-PB 275 CG30278-PB 1..275 1..275 1487 100 Plus
CG30278-PA 275 CG30278-PA 1..275 1..275 1487 100 Plus
CG4286-PA 219 CG4286-PA 92..217 96..221 172 33.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19619-PA 140 GI19619-PA 2..94 115..207 274 52.7 Plus
Dmoj\GI19622-PA 118 GI19622-PA 1..72 148..219 152 40.3 Plus
Dmoj\GI18765-PA 213 GI18765-PA 99..211 108..221 152 31.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16937-PA 261 GL16937-PA 1..227 1..228 688 56.5 Plus
Dper\GL10168-PA 211 GL10168-PA 89..209 101..221 180 35.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15746-PA 261 GA15746-PA 1..227 1..228 680 55.7 Plus
Dpse\GA18082-PA 211 GA18082-PA 89..209 101..221 179 35.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:03:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15652-PA 271 GM15652-PA 1..245 1..245 1235 93.9 Plus
Dsec\GM15741-PA 219 GM15741-PA 92..217 96..221 167 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25219-PA 219 GD25219-PA 92..217 96..221 167 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:03:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14986-PA 255 GJ14986-PA 3..214 5..219 490 46.8 Plus
Dvir\GJ14988-PA 265 GJ14988-PA 7..214 5..219 414 41.3 Plus
Dvir\GJ21789-PA 218 GJ21789-PA 96..216 101..221 146 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20835-PA 306 GK20835-PA 13..276 3..228 423 37.3 Plus
Dwil\GK21399-PA 218 GK21399-PA 96..216 101..221 165 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11691-PA 275 GE11691-PA 1..245 1..244 1163 88.6 Plus
Dyak\GE13735-PA 219 GE13735-PA 92..217 96..221 170 32.3 Plus

FI08015.hyp Sequence

Translation from 101 to 928

> FI08015.hyp
MSAPENSCRRWIKKNWVDGPCKKCFESTCGPCIDYRVSPPAADLPEPQAE
VVKAVIEPDGPVRQEINIRAECSKGRPLLESDKDKLRCCTMCVAQEQNLH
PNLCSAQCRPLKTYLHLNEWTKRPLPKPTYKHSVILDNNTIVGRCFPMKF
QLRRTKKNCLDCGNELYYRYPITNNSDLLLIKNCCEVEVYPAKKVENMNN
VRVTKISGVKKFANSLLKEHSECRLFTLASQLAKQKPPLAPDVRMSRMSR
KSRKSRKSRKSSRKSSLFGNKKGKK*

FI08015.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG30278-PC 275 CG30278-PC 1..275 1..275 1487 100 Plus
CG30278-PB 275 CG30278-PB 1..275 1..275 1487 100 Plus
CG30278-PA 275 CG30278-PA 1..275 1..275 1487 100 Plus
CG4286-PA 219 CG4286-PA 92..217 96..221 172 33.1 Plus