Clone FI08019 Report

Search the DGRC for FI08019

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:19
Vector:pOTB7
Associated Gene/TranscriptTim17a1-RA
Protein status:FI08019.pep: gold
Sequenced Size:916

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Tim17a1 2008-08-15 Release 5.9 accounting
Tim17a1 2008-12-18 5.12 accounting

Clone Sequence Records

FI08019.complete Sequence

916 bp assembled on 2008-07-29

GenBank Submission: BT044366.1

> FI08019.complete
ACTCAAAAGTCTATTTCCAAAACACAAGTTTTTGATTTGAAGCCACTTGA
AGAATATTAGTATACCCAAAGGTTTTGATATAGTAAGTCAAGGCCATGGA
GTACAATCGCCAGCCGTGTCCCATTAGGATTGTGGAGGATTGCGGATGTG
CCTTCATGATGGGCACCATCGGTGGTTCGCTGTTCGAGTTCCTCAAGGGT
TTCCGTAACGCTCCTACCGGATTGCAGCGCAGACTTTATGGTGGCATTGA
TTTGGTGAAGATGAGAACGCCGTCCATTGCCGGCAGCTTTGCCGTTTGGG
GTGCCACTTTCAGCACAGTGGATTGCGCCCTGGTCCACTATCGCCAGAGG
GAGGATGCCTGGAACTCGATACTCAGTGGAGCGGCCACTGGTGGGATATT
GGCAGCCCGTAATGGCATTCGGGCCATGGCCAACAGTGCTCTGGTGGGCT
GTCTGGTGCTGGCCATGATTGAAGGAGCCGGTGCAGCAGTGGCCACCATT
AATGCAGCCGACAAAGGTGCAGGGATAGTCATCAAGCCGCAGCGGGCCCA
GTGGGAGGCCATACTGGAGACTATTGATCCGAAGAGAGCGTCATCCACTC
AAGATTTCGCACTGGCGGAGTTTGAACGGGTGCTGGACAAATGTCGGGCG
AGCAGGGAACCAAATTTACTTCAGGACATTCCGGTTAAGAGTCACGAGCG
AGATTCCAAACAGAAGCCATTTTATTCCCTCTTGGATCTGGTGAAACTGT
CCCAGATGTTCTAGTGTTGCCCAAAAAAAAAGGGTTTTCATTTTCATTCA
ATCTTTCGTTCTCAACAATCACTCATCAAAATTGTGTGCATGTACTAGTT
TTCACCGTTCATTTCATGATCGTAATATACAAAACGCATAAGATACTAAA
AAAAAAAAAAAAAAAA

FI08019.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17a1-RA 1014 Tim17a1-RA 1..900 1..900 4500 100 Plus
Tim17a2.a 758 Tim17a2.a 242..494 254..506 575 81.8 Plus
Tim17a2-RA 675 Tim17a2-RA 159..411 254..506 575 81.8 Plus
Tim17a2.a 758 Tim17a2.a 83..202 95..214 390 88.3 Plus
Tim17a2-RA 675 Tim17a2-RA 1..119 96..214 385 88.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:27:30
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8189161..8190057 897..1 4485 100 Minus
chr3R 27901430 chr3R 1084399..1084810 506..95 875 80.8 Minus
chr2L 23010047 chr2L 15483764..15483849 309..394 190 81.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12363781..12364680 900..1 4500 100 Minus
3R 32079331 3R 5258735..5259146 506..95 875 80.8 Minus
2L 23513712 2L 15485053..15485138 309..394 190 81.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12104612..12105511 900..1 4500 100 Minus
3R 31820162 3R 4999566..4999818 506..254 575 81.8 Minus
3R 31820162 3R 4999858..4999977 214..95 390 88.3 Minus
2L 23513712 2L 15485053..15485138 309..394 190 81.3 Plus
Blast to na_te.dros performed on 2019-03-16 15:27:29 has no hits.

FI08019.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:28:32 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8189161..8190057 1..897 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:21 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..669 96..764 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:24 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..669 96..764 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:11:01 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..669 96..764 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:51 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..669 96..764 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:20 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..669 96..764 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:23 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:24 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:11:01 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:39 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..897 1..897 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:20 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
Tim17a1-RA 1..897 1..897 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:32 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12363784..12364680 1..897 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:32 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12363784..12364680 1..897 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:28:32 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12363784..12364680 1..897 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:11:01 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8189506..8190402 1..897 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:56 Download gff for FI08019.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12104615..12105511 1..897 100   Minus

FI08019.pep Sequence

Translation from 95 to 763

> FI08019.pep
MEYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGG
IDLVKMRTPSIAGSFAVWGATFSTVDCALVHYRQREDAWNSILSGAATGG
ILAARNGIRAMANSALVGCLVLAMIEGAGAAVATINAADKGAGIVIKPQR
AQWEAILETIDPKRASSTQDFALAEFERVLDKCRASREPNLLQDIPVKSH
ERDSKQKPFYSLLDLVKLSQMF*

FI08019.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16065-PA 224 GF16065-PA 1..224 1..222 807 69 Plus
Dana\GF15488-PA 206 GF15488-PA 1..206 1..222 659 58.3 Plus
Dana\GF20543-PA 171 GF20543-PA 3..138 2..137 477 64 Plus
Dana\GF18933-PA 184 GF18933-PA 3..138 2..137 465 60.3 Plus
Dana\GF15384-PA 181 GF15384-PA 3..138 2..137 458 61 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17140-PA 222 GG17140-PA 1..222 1..222 1097 91 Plus
Dere\GG13145-PA 173 GG13145-PA 3..138 2..137 482 64 Plus
Dere\GG12726-PA 175 GG12726-PA 3..138 2..137 473 61.8 Plus
Dere\GG25162-PA 177 GG25162-PA 3..130 2..129 452 62.5 Plus
Dere\GG17552-PA 186 GG17552-PA 3..130 2..129 447 61.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22709-PA 232 GH22709-PA 2..229 1..222 692 61 Plus
Dgri\GH19590-PA 172 GH19590-PA 3..138 2..137 477 62.5 Plus
Dgri\GH13757-PA 172 GH13757-PA 3..130 2..129 469 64.8 Plus
Dgri\GH17768-PA 185 GH17768-PA 3..138 2..137 461 61.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:06
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17a1-PB 222 CG10090-PB 1..222 1..222 1142 100 Plus
Tim17a1-PA 222 CG10090-PA 1..222 1..222 1142 100 Plus
Tim17a2-PA 224 CG14666-PA 1..223 1..221 720 63.1 Plus
Tim17b-PB 173 CG40451-PB 3..138 2..137 481 64.7 Plus
Tim17b-PA 173 CG40451-PA 3..138 2..137 481 64.7 Plus
Tim17b2-PC 176 CG15257-PC 3..130 2..129 459 64.8 Plus
Tim17b2-PA 176 CG15257-PA 3..130 2..129 459 64.8 Plus
CG1724-PA 185 CG1724-PA 3..138 2..137 452 60.3 Plus
Tim17b1-PA 179 CG1158-PA 3..138 2..137 445 59.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes127-PA 223 GI10214-PA 2..220 1..222 709 62.4 Plus
Dmoj\GI23631-PA 172 GI23631-PA 3..138 2..137 485 64 Plus
Dmoj\GI17897-PA 177 GI17897-PA 3..138 2..137 476 63.2 Plus
Dmoj\GI22546-PA 217 GI22546-PA 3..138 2..137 463 61.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22194-PA 202 GL22194-PA 1..195 1..195 635 63.7 Plus
Dper\GL14996-PA 191 GL14996-PA 1..162 1..158 602 69.9 Plus
Dper\GL12286-PA 173 GL12286-PA 3..138 2..137 481 63.2 Plus
Dper\GL26428-PA 171 GL26428-PA 3..138 2..137 438 59.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13158-PA 202 GA13158-PA 1..195 1..195 638 64.7 Plus
Dpse\GA22481-PA 191 GA22481-PA 1..162 1..158 605 70.6 Plus
Dpse\GA26255-PA 173 GA26255-PA 3..138 2..137 481 63.2 Plus
Dpse\GA26353-PA 172 GA26353-PA 3..137 5..140 480 63.2 Plus
Dpse\GA28858-PA 171 GA28858-PA 3..138 2..137 438 59.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26023-PA 222 GM26023-PA 1..222 1..222 1145 96.4 Plus
Dsec\GM10651-PA 224 GM10651-PA 1..223 1..221 754 64.8 Plus
Dsec\GM23215-PA 173 GM23215-PA 3..138 2..137 485 64.7 Plus
Dsec\GM22636-PA 185 GM22636-PA 3..138 2..137 460 61 Plus
Dsec\GM10800-PA 179 GM10800-PA 3..138 2..137 452 59.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20580-PA 222 GD20580-PA 1..222 1..222 1153 96.8 Plus
Dsim\GD19633-PA 224 GD19633-PA 1..223 1..221 756 64.4 Plus
Dsim\GD24434-PA 185 GD24434-PA 3..138 2..137 462 61 Plus
Dsim\GD19775-PA 179 GD19775-PA 3..138 2..137 449 58.8 Plus
Dsim\GD24009-PA 420 GD24009-PA 3..130 2..129 447 63.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11015-PA 224 GJ11015-PA 2..222 1..222 730 64.9 Plus
Dvir\GJ11192-PA 172 GJ11192-PA 3..138 2..137 474 63.2 Plus
Dvir\GJ17402-PA 177 GJ17402-PA 3..138 2..137 472 62.5 Plus
Dvir\GJ10150-PA 189 GJ10150-PA 3..137 2..137 447 61.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:32:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12238-PA 173 GK12238-PA 3..138 2..137 483 63.2 Plus
Dwil\GK18250-PA 179 GK18250-PA 3..138 2..137 472 61.8 Plus
Dwil\GK12968-PA 180 GK12968-PA 3..138 2..137 451 58.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:32:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24530-PA 222 GE24530-PA 1..222 1..222 1110 92.8 Plus
Dyak\GE21001-PA 177 GE21001-PA 3..130 2..129 462 64.1 Plus
Dyak\GE25459-PA 179 GE25459-PA 3..138 2..137 460 60.3 Plus
Dyak\GE15312-PA 185 GE15312-PA 3..138 2..137 455 61 Plus

FI08019.hyp Sequence

Translation from 95 to 763

> FI08019.hyp
MEYNRQPCPIRIVEDCGCAFMMGTIGGSLFEFLKGFRNAPTGLQRRLYGG
IDLVKMRTPSIAGSFAVWGATFSTVDCALVHYRQREDAWNSILSGAATGG
ILAARNGIRAMANSALVGCLVLAMIEGAGAAVATINAADKGAGIVIKPQR
AQWEAILETIDPKRASSTQDFALAEFERVLDKCRASREPNLLQDIPVKSH
ERDSKQKPFYSLLDLVKLSQMF*

FI08019.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:36
Subject Length Description Subject Range Query Range Score Percent Strand
Tim17a1-PB 222 CG10090-PB 1..222 1..222 1142 100 Plus
Tim17a1-PA 222 CG10090-PA 1..222 1..222 1142 100 Plus
Tim17a2-PA 224 CG14666-PA 1..223 1..221 720 63.1 Plus
Tim17b-PB 173 CG40451-PB 3..138 2..137 481 64.7 Plus
Tim17b-PA 173 CG40451-PA 3..138 2..137 481 64.7 Plus