Clone FI08020 Report

Search the DGRC for FI08020

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:20
Vector:pOTB7
Associated Gene/TranscriptCG14537-RA
Protein status:FI08020.pep: gold
Sequenced Size:811

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14537 2008-08-15 Release 5.9 accounting
CG14537 2008-12-18 5.12 accounting

Clone Sequence Records

FI08020.complete Sequence

811 bp assembled on 2008-07-28

GenBank Submission: BT044367.1

> FI08020.complete
CTGACACTCATTTTCATACGAAAATTTATAAATTGGTGCCAAAACTCGAT
AGTTGGCAATGAGCGAACCGCTCTCGGGTCGGTGGCTGCGTTTCGTTTAC
AATGGCCTGTTGTTGGCTTCGGCTGTCTGTACCGGCCGTAAAATGCTGCC
GGAGGAGCACCCCTTCGCCATGGTCGCTTGTGTTGTGGTCGGATTCTCGG
CGGTATTTGGACTGCTCCGGGTTATCTTCGCCAGCGGACAGCCGGAGGAG
TGCCAACAACTGAGGGATATAACCAGTGGAGTCCTGGAACTGGCACCTTT
GCCCCTGGCCAATATGGATTTCTATATGCAGTCCACCGGGTTGAGTCCCA
TTGCCTTGGGACATGCCTTCTTCGTGCTTCCACTGTTTTGCGATTTGGGT
TGCAGCCTGGCGAAAGATCGGCGAGATTGTGCCTTCAGCGACAGCTTGCG
GAATCTCACGGTTCTGGGCAATATTGTGTCCCTCGGCTTTCTGGCCTATG
TGGAGCGGAATTTTCTCTATTTGCGAATGGTGCTGGTCATGATTGTGGTC
AAGTATGGTGTGGTTCTGGTGGACAGCATCAAGGAGGACGCCGGTGAGGA
TCTGCAGGTGTGCGGCACAGCGCTTTTTATGCACCTGCTCGGCAAGGCCG
TGGTGTCTTCCACTACGTGACCCGATCCTTGGGTTAACCCCTAACCGCGC
TCCGCTTCGAGGGTTTCATTGTACCGCTTAATTTTCCATGAATAGAGTTT
TGACCCGTATTAAATTTCATTTCACCCGCTTTAAAAAAAAAAAAAAAAAA
AAAAAAAAAAA

FI08020.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG14537-RA 782 CG14537-RA 1..782 1..782 3835 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:11:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7839547..7840328 1..782 3850 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:11:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7840481..7841262 1..782 3835 99.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7840481..7841262 1..782 3835 99.3 Plus
Blast to na_te.dros performed on 2019-03-15 15:11:41 has no hits.

FI08020.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:12:22 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7839547..7840328 1..782 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:23 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..612 59..670 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:11 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..612 59..670 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:06:46 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..612 59..670 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:12 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..612 59..670 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:31:03 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..612 59..670 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:27 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..782 1..782 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:11 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..782 1..782 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:06:46 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 30..811 1..782 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:20 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 1..782 1..782 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:31:03 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
CG14537-RA 30..811 1..782 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:22 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7840481..7841262 1..782 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:22 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7840481..7841262 1..782 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:12:22 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7840481..7841262 1..782 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:06:46 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7840481..7841262 1..782 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:30 Download gff for FI08020.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7840481..7841262 1..782 99   Plus

FI08020.hyp Sequence

Translation from 58 to 669

> FI08020.hyp
MSEPLSGRWLRFVYNGLLLASAVCTGRKMLPEEHPFAMVACVVVGFSAVF
GLLRVIFASGQPEECQQLRDITSGVLELAPLPLANMDFYMQSTGLSPIAL
GHAFFVLPLFCDLGCSLAKDRRDCAFSDSLRNLTVLGNIVSLGFLAYVER
NFLYLRMVLVMIVVKYGVVLVDSIKEDAGEDLQVCGTALFMHLLGKAVVS
STT*

FI08020.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14537-PA 203 CG14537-PA 1..203 1..203 1035 100 Plus
CG14269-PB 190 CG14269-PB 7..183 13..194 238 32.6 Plus
CG14269-PA 190 CG14269-PA 7..183 13..194 238 32.6 Plus
CG12679-PA 190 CG12679-PA 9..187 15..198 234 31.9 Plus
CG16782-PA 200 CG16782-PA 10..196 13..198 213 31.6 Plus

FI08020.pep Sequence

Translation from 58 to 669

> FI08020.pep
MSEPLSGRWLRFVYNGLLLASAVCTGRKMLPEEHPFAMVACVVVGFSAVF
GLLRVIFASGQPEECQQLRDITSGVLELAPLPLANMDFYMQSTGLSPIAL
GHAFFVLPLFCDLGCSLAKDRRDCAFSDSLRNLTVLGNIVSLGFLAYVER
NFLYLRMVLVMIVVKYGVVLVDSIKEDAGEDLQVCGTALFMHLLGKAVVS
STT*

FI08020.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21842-PA 203 GF21842-PA 1..203 1..203 763 71.9 Plus
Dana\GF19608-PA 190 GF19608-PA 7..183 13..194 255 33.5 Plus
Dana\GF21789-PA 200 GF21789-PA 29..196 31..198 218 33.1 Plus
Dana\GF20145-PA 190 GF20145-PA 6..188 13..199 200 30.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10502-PA 205 GG10502-PA 1..203 1..203 963 90.6 Plus
Dere\GG18584-PA 189 GG18584-PA 7..182 13..194 231 32.4 Plus
Dere\GG10445-PA 190 GG10445-PA 9..188 15..199 226 33.9 Plus
Dere\GG18583-PA 200 GG18583-PA 25..178 28..180 210 32.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10209-PA 201 GH10209-PA 1..200 1..198 443 49 Plus
Dgri\GH10086-PA 201 GH10086-PA 1..200 1..198 443 49 Plus
Dgri\GH12189-PA 191 GH12189-PA 7..191 13..202 235 32.8 Plus
Dgri\GH12188-PA 198 GH12188-PA 26..189 29..193 205 31 Plus
Dgri\GH12187-PA 198 GH12187-PA 26..189 29..193 205 31 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG14537-PA 203 CG14537-PA 1..203 1..203 1035 100 Plus
CG14269-PB 190 CG14269-PB 7..183 13..194 238 32.6 Plus
CG14269-PA 190 CG14269-PA 7..183 13..194 238 32.6 Plus
CG12679-PA 190 CG12679-PA 9..187 15..198 234 31.9 Plus
CG16782-PA 200 CG16782-PA 10..196 13..198 213 31.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17049-PA 214 GI17049-PA 1..212 1..202 567 50.5 Plus
Dmoj\GI14347-PA 191 GI14347-PA 7..191 13..202 238 32.8 Plus
Dmoj\GI14346-PA 197 GI14346-PA 26..178 29..183 194 30.4 Plus
Dmoj\GI12294-PA 187 GI12294-PA 9..154 17..167 170 30.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18648-PA 202 GL18648-PA 1..199 1..198 628 65.3 Plus
Dper\GL25846-PA 189 GL25846-PA 7..182 13..194 256 35 Plus
Dper\GL12881-PA 197 GL12881-PA 13..193 17..198 227 33 Plus
Dper\GL21045-PA 175 GL21045-PA 2..172 27..200 159 30.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25738-PA 202 GA25738-PA 1..199 1..198 628 65.3 Plus
Dpse\GA25469-PA 189 GA25469-PA 7..182 13..194 255 35 Plus
Dpse\GA14144-PA 197 GA14144-PA 13..193 17..198 229 33.5 Plus
Dpse\GA22616-PA 177 GA22616-PA 7..135 13..146 177 32.8 Plus
Dpse\GA29046-PA 176 GA29046-PA 2..124 27..151 162 35.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16621-PA 203 GM16621-PA 1..203 1..203 1031 97.5 Plus
Dsec\GM18835-PA 190 GM18835-PA 7..183 13..194 240 30.8 Plus
Dsec\GM12727-PA 200 GM12727-PA 25..196 28..198 216 30.7 Plus
Dsec\GM24886-PA 191 GM24886-PA 9..165 15..176 210 33.7 Plus
Dsec\GM22678-PA 186 GM22678-PA 9..160 15..171 209 35.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23493-PA 203 GD23493-PA 1..203 1..203 1033 97.5 Plus
Dsim\GD16333-PA 190 GD16333-PA 7..183 13..194 247 31.3 Plus
Dsim\GD16332-PA 200 GD16332-PA 25..196 28..198 216 30.7 Plus
Dsim\GD21775-PA 188 GD21775-PA 9..184 15..194 207 33 Plus
Dsim\GD15540-PA 186 GD15540-PA 9..160 15..171 206 36.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10100-PA 220 GJ10100-PA 1..212 1..196 573 53.8 Plus
Dvir\GJ19395-PA 191 GJ19395-PA 7..191 13..202 243 33.3 Plus
Dvir\GJ13231-PA 192 GJ13231-PA 11..185 17..194 222 32.6 Plus
Dvir\GJ19394-PA 197 GJ19394-PA 26..178 29..183 205 32.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23972-PA 205 GK23972-PA 1..196 1..196 666 65.3 Plus
Dwil\GK10152-PA 192 GK10152-PA 3..183 9..194 242 33.5 Plus
Dwil\GK14574-PA 195 GK14574-PA 7..193 13..199 203 29 Plus
Dwil\GK10151-PA 199 GK10151-PA 15..177 17..180 183 29.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14641-PA 203 GE14641-PA 1..203 1..203 979 92.1 Plus
Dyak\GE16896-PA 190 GE16896-PA 7..183 13..194 256 33.5 Plus
Dyak\GE15354-PA 190 GE15354-PA 9..183 15..194 237 34.8 Plus
Dyak\GE16895-PA 200 GE16895-PA 25..196 28..198 217 32.4 Plus