Clone FI08029 Report

Search the DGRC for FI08029

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:29
Vector:pOTB7
Associated Gene/TranscriptCG5614-RA
Protein status:FI08029.pep: gold
Sequenced Size:1306

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5614 2008-08-15 Release 5.9 accounting
CG5614 2008-12-18 5.12 accounting

Clone Sequence Records

FI08029.complete Sequence

1306 bp assembled on 2008-08-14

GenBank Submission: BT044374.1

> FI08029.complete
TTCAAATTGAACGTACATAAATTGTTGAGGTCATCAGTGTAGATATAAAA
TTTATAAAGTGTATGTTTTGTTAACTTAAATTAGTTTAGTACAAAATTCA
CAACCATGAGTTCGCATAAGATTAACCTGGAGAATGCCTACCAGAAGATG
ATAGAACAGAATATCAAAAGTCAGTTGGAGAAAAATGGAACCATGGCGGC
ACTACGGAGCGAAATGCACGTGAAGATCCTCCAGATGATACGTGGCCAGC
AGAATAAGTCCAAAGTCCAAGCACTCACTGGTGGATCCAATCAATCGGAG
GATCACAGCCTGGTCAAGCTGATCAACCAGATGATTATGGAGTTCCTCGA
TTGGTTCGGCTACAAGCACACCATGGAAACATTTCGCATGGAGACGGGTG
AAAACGTGGCCAATCGCAGGGAGATGGAACAAAGTCTACACATCACACCC
GAGTCAAAGGATTTTCCGCTCCTGGCTCAACTAGTTATGCGCGATTGGAA
GTTCGGTGTGCAAAAAGGAGGTTCCAAAAAGTTGGTTCAGCTACCGGATC
CTATGGAGGCCACTGTGCAAAGGAGTCGAAAATTGGTACAGGAACTAAAA
GTTATGAGAGCACAAAAATCAGAAGTTAACCAAGGCAGACTAGTTCAAAA
CAATCGAAAACTCATCACTAATAATACGTTCACGAAAGGTCTCACACCCA
AGAGCATTAGTACTCCACCTCGTTCGATCAAGAACGAGAATCCGAAGTCA
TACGTAGATAGTTCTGAATCCGATGTCCTGGAATCTGATTACAGCGAAGA
AGAATCGGAGGACAGTGACGCATATAAGGACATACCCGATAGACAGATAT
TTATCGATGACTTGCCGCCAGAGGGAAAATATGCCCCAAATTATGGAGAA
GAAGGTCCTTTTGAGGGTAAACAAAATCAGGCAAATGAACGCGACAATAT
TCCGAGCACATCGAGGAAGCAACATTTTTCAAGGAAGCCAGAAACTGAAA
GTTCCGACTCTGATGATAAGCCTTCGATCAGTGGAATAAATAAAGTTTCA
AGGCAGGACTATTGGAATTCCCCGCGAGGAGTGCAACTACGGAACAAAAA
TACCTTAAAACCGGAGGAAGAATGTGATACCCACATAAGAAAAGTCAATT
TAGACAGCGATTACAGCTCGGATGAAGATTGATCAATGCCAGAAGTTCCT
TATTTTTAAATTAGAAAGTCAATTTGTGTATGACAGTTGTCTTGGAAATT
TCTTGCAGCTACACTAATAAACAATACATTTTGATTGGAAAAAAAAAAAA
AAAAAA

FI08029.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5614-RA 1288 CG5614-RA 1..1288 1..1288 6410 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:14:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11604420..11605707 1..1288 6350 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:14:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15779805..15781093 1..1289 6415 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15520636..15521924 1..1289 6415 99.8 Plus
Blast to na_te.dros performed on 2019-03-15 23:14:47 has no hits.

FI08029.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:15:34 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11604420..11605707 1..1288 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:33 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1077 106..1182 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:50 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1077 106..1182 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:34:40 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1077 106..1182 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:20 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1077 106..1182 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:25:54 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1077 106..1182 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:31:45 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1182 1..1182 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:50 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1288 1..1288 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:34:40 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1288 1..1288 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:19 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1182 1..1182 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:25:54 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
CG5614-RA 1..1288 1..1288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:34 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15779805..15781092 1..1288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:34 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15779805..15781092 1..1288 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:15:34 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15779805..15781092 1..1288 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:34:40 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11605527..11606814 1..1288 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:35:56 Download gff for FI08029.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15520636..15521923 1..1288 99   Plus

FI08029.pep Sequence

Translation from 105 to 1181

> FI08029.pep
MSSHKINLENAYQKMIEQNIKSQLEKNGTMAALRSEMHVKILQMIRGQQN
KSKVQALTGGSNQSEDHSLVKLINQMIMEFLDWFGYKHTMETFRMETGEN
VANRREMEQSLHITPESKDFPLLAQLVMRDWKFGVQKGGSKKLVQLPDPM
EATVQRSRKLVQELKVMRAQKSEVNQGRLVQNNRKLITNNTFTKGLTPKS
ISTPPRSIKNENPKSYVDSSESDVLESDYSEEESEDSDAYKDIPDRQIFI
DDLPPEGKYAPNYGEEGPFEGKQNQANERDNIPSTSRKQHFSRKPETESS
DSDDKPSISGINKVSRQDYWNSPRGVQLRNKNTLKPEEECDTHIRKVNLD
SDYSSDED*

FI08029.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18538-PA 421 GF18538-PA 1..405 1..355 643 39.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:44:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16948-PA 388 GG16948-PA 1..388 1..358 1280 67.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18218-PA 369 GH18218-PA 3..284 9..274 302 30.3 Plus
Dgri\GH18217-PA 182 GH18217-PA 3..124 9..130 153 24.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG5614-PA 358 CG5614-PA 1..358 1..358 1855 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:44:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10172-PA 397 GI10172-PA 1..294 8..270 323 30.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:44:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12706-PA 532 GL12706-PA 11..159 10..150 327 43.6 Plus
Dper\GL12706-PA 532 GL12706-PA 236..378 140..276 175 38.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19008-PA 532 GA19008-PA 11..159 10..150 324 43.6 Plus
Dpse\GA19008-PA 532 GA19008-PA 236..378 140..276 184 38.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24255-PA 362 GM24255-PA 1..362 1..358 1631 89.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19044-PA 362 GD19044-PA 1..362 1..358 1641 90.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10872-PA 614 GJ10872-PA 205..332 2..129 241 33.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11416-PA 377 GK11416-PA 8..376 7..356 431 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24334-PA 383 GE24334-PA 1..383 1..358 1301 67.6 Plus

FI08029.hyp Sequence

Translation from 105 to 1181

> FI08029.hyp
MSSHKINLENAYQKMIEQNIKSQLEKNGTMAALRSEMHVKILQMIRGQQN
KSKVQALTGGSNQSEDHSLVKLINQMIMEFLDWFGYKHTMETFRMETGEN
VANRREMEQSLHITPESKDFPLLAQLVMRDWKFGVQKGGSKKLVQLPDPM
EATVQRSRKLVQELKVMRAQKSEVNQGRLVQNNRKLITNNTFTKGLTPKS
ISTPPRSIKNENPKSYVDSSESDVLESDYSEEESEDSDAYKDIPDRQIFI
DDLPPEGKYAPNYGEEGPFEGKQNQANERDNIPSTSRKQHFSRKPETESS
DSDDKPSISGINKVSRQDYWNSPRGVQLRNKNTLKPEEECDTHIRKVNLD
SDYSSDED*

FI08029.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG5614-PA 358 CG5614-PA 1..358 1..358 1855 100 Plus