Clone FI08034 Report

Search the DGRC for FI08034

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:34
Vector:pOTB7
Associated Gene/TranscriptCG3199-RA
Protein status:FI08034.pep: gold
Sequenced Size:881

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3199 2008-08-15 Release 5.9 accounting
CG3199 2008-12-18 5.12 accounting

Clone Sequence Records

FI08034.complete Sequence

881 bp assembled on 2008-07-28

GenBank Submission: BT032666

> FI08034.complete
GAGGGTTTCCCAATTTATCTGCTAAAAATTATGTAGCCGAAATAATGTTT
GACTAGAATCTGCAACCAAGGCCCGTTTCCAGAGTACCGCAGTCCCATTG
GACCTCGCCCATCCTGAAAAATGCCGAAGAAGGGAAAAGACAAGGGGAAG
AAAGGAAAGAAAAGTGTTTTCAGAGCCAAGTCTACAGTGGTGCCCACAGC
ACCTCCAGAACCAGTGTTCGATAGAAATTTGCCCGTTTTCTCCTTCGATC
TTGTTATCACCCGACTGGAGGTAAAGGGTGTGGTCCTGGCCGACGCAAGA
AAACTGCTGGTGAAGGTCAAATTTGGTGGCAACAATCTCAGTCTTACGGC
TAGTAGAACCAATGTGAGCGAGTTCAAGCCGAATGCCAGTCACACCTTTC
AGGCGGAGCCACCGAATCTAGCCCAGACAGTCGAAGAAAATGGCATAGAC
TTTGAGGTGGTGTACGATGAGCAAGTTGTTGGCTTGGGTAAACTGAGCCT
GCCCAAAAGATTAAGCACAAGAATAAAGCTGGACATGAAGGCATTCTCCT
ACACGAGCACTTGTCCCCTGGAAATGGAGGGGAAGCCAGTTGGCGCATTA
GAGTTCCTTTGCAAGCTGTTCATCAAATGTGGCGATTATGCCAGAGAGGG
CGAAACTTGCCCCAATTTGGACAGGAACCTTAGCCCAAGGGACATAGTAT
TTGTGGTCGGCAAATCGCAGGCCAATACCAGCTGCTGCGATCCCTGTCGA
GATGCTCTGGAAATCGAGGCGAGAAAACAGAAAGACTACAGTATTCAATC
GAGTTCTAGTCGAAAATAGAGTAATTTAAGGTTCATAACTATCCAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI08034.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG3199-RA 971 CG3199-RA 27..867 5..845 4175 99.7 Plus
CG3199.a 831 CG3199.a 69..831 82..844 3815 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:15:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9987597..9988236 5..644 3170 99.7 Plus
chr3R 27901430 chr3R 9988292..9988494 642..844 1015 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14162729..14163368 5..644 3170 99.7 Plus
3R 32079331 3R 14163423..14163626 642..845 1020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13903560..13904199 5..644 3170 99.6 Plus
3R 31820162 3R 13904254..13904457 642..845 1020 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:15:15 has no hits.

FI08034.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:16:20 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9987595..9988236 1..644 99 -> Plus
chr3R 9988295..9988494 645..844 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:39 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 1..699 121..819 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:15 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 1..699 121..819 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:51:00 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 1..699 121..819 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:30 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 1..699 121..819 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:37:50 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 1..699 121..819 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:32 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 9..850 1..844 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:14 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 9..850 1..844 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:51:00 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 19..860 1..844 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:26 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 9..850 1..844 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:37:50 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
CG3199-RA 19..860 1..844 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:20 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14163426..14163625 645..844 100   Plus
3R 14162727..14163368 1..644 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:20 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14163426..14163625 645..844 100   Plus
3R 14162727..14163368 1..644 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:16:20 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14163426..14163625 645..844 100   Plus
3R 14162727..14163368 1..644 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:51:00 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9989148..9989347 645..844 100   Plus
arm_3R 9988449..9989090 1..644 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:35 Download gff for FI08034.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13903558..13904199 1..644 99 -> Plus
3R 13904257..13904456 645..844 100   Plus

FI08034.hyp Sequence

Translation from 120 to 818

> FI08034.hyp
MPKKGKDKGKKGKKSVFRAKSTVVPTAPPEPVFDRNLPVFSFDLVITRLE
VKGVVLADARKLLVKVKFGGNNLSLTASRTNVSEFKPNASHTFQAEPPNL
AQTVEENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLDMKAFSYTSTCPL
EMEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQ
ANTSCCDPCRDALEIEARKQKDYSIQSSSSRK*

FI08034.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG3199-PA 232 CG3199-PA 1..232 1..232 1196 100 Plus
CG14355-PA 1024 CG14355-PA 5..212 13..216 353 38.9 Plus
CG31533-PA 844 CG31533-PA 7..171 40..205 185 28.3 Plus

FI08034.pep Sequence

Translation from 120 to 818

> FI08034.pep
MPKKGKDKGKKGKKSVFRAKSTVVPTAPPEPVFDRNLPVFSFDLVITRLE
VKGVVLADARKLLVKVKFGGNNLSLTASRTNVSEFKPNASHTFQAEPPNL
AQTVEENGIDFEVVYDEQVVGLGKLSLPKRLSTRIKLDMKAFSYTSTCPL
EMEGKPVGALEFLCKLFIKCGDYAREGETCPNLDRNLSPRDIVFVVGKSQ
ANTSCCDPCRDALEIEARKQKDYSIQSSSSRK*

FI08034.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16239-PA 242 GF16239-PA 20..234 19..225 670 63.3 Plus
Dana\GF18784-PA 1013 GF18784-PA 22..219 29..231 284 32 Plus
Dana\GF18780-PA 1039 GF18780-PA 5..141 29..170 200 30.3 Plus
Dana\GF18782-PA 914 GF18782-PA 9..139 39..170 168 30.3 Plus
Dana\GF18781-PA 963 GF18781-PA 9..139 39..170 164 27.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16843-PA 233 GG16843-PA 16..233 15..232 990 89.9 Plus
Dere\GG21461-PA 1027 GG21461-PA 35..212 39..216 331 39.3 Plus
Dere\GG21443-PA 844 GG21443-PA 7..188 40..197 188 28.6 Plus
Dere\GG21437-PA 861 GG21437-PA 12..195 40..197 152 26.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19689-PA 944 GH19689-PA 6..184 40..216 325 38 Plus
Dgri\GH23723-PA 944 GH23723-PA 6..184 40..216 325 38 Plus
Dgri\GH23735-PA 960 GH23735-PA 5..182 39..214 312 35.4 Plus
Dgri\GH23716-PA 859 GH23716-PA 5..192 30..216 277 34 Plus
Dgri\GH19688-PA 859 GH19688-PA 5..192 30..216 276 33.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG3199-PA 232 CG3199-PA 1..232 1..232 1196 100 Plus
CG14355-PA 1024 CG14355-PA 5..212 13..216 353 38.9 Plus
CG31533-PA 844 CG31533-PA 7..171 40..205 185 28.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24547-PA 991 GI24547-PA 6..182 40..216 294 34.1 Plus
Dmoj\GI24545-PA 963 GI24545-PA 8..202 37..224 264 32.3 Plus
Dmoj\GI24546-PA 492 GI24546-PA 6..181 40..214 258 32 Plus
Dmoj\GI24549-PA 1916 GI24549-PA 7..183 39..213 256 33.3 Plus
Dmoj\GI24549-PA 1916 GI24549-PA 961..1143 45..227 222 31.2 Plus
Dmoj\GI24544-PA 455 GI24544-PA 6..162 40..196 208 31.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23303-PA 893 GL23303-PA 24..221 21..216 415 41.9 Plus
Dper\GL23304-PA 1041 GL23304-PA 25..214 29..216 405 42.6 Plus
Dper\GL23536-PA 193 GL23536-PA 11..189 40..216 383 42.5 Plus
Dper\GL23302-PA 818 GL23302-PA 5..204 40..231 242 31.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27215-PA 893 GA27215-PA 24..221 21..216 406 41.4 Plus
Dpse\GA27216-PA 1074 GA27216-PA 25..214 29..216 396 42.1 Plus
Dpse\GA27295-PA 193 GA27295-PA 11..189 40..216 374 41.3 Plus
Dpse\GA16184-PA 819 GA16184-PA 5..204 40..231 240 31.5 Plus
Dpse\GA23259-PA 144 GA23259-PA 4..99 123..216 193 40.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24154-PA 232 GM24154-PA 1..232 1..232 1178 96.6 Plus
Dsec\GM25881-PA 1022 GM25881-PA 33..212 37..216 316 37.2 Plus
Dsec\GM25876-PA 844 GM25876-PA 7..188 40..197 163 25.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18950-PA 232 GD18950-PA 1..232 1..232 1178 96.6 Plus
Dsim\GD20450-PA 1022 GD20450-PA 35..212 39..216 307 37.1 Plus
Dsim\GD20447-PA 844 GD20447-PA 7..188 40..197 162 25.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22613-PA 934 GJ22613-PA 5..183 40..216 320 38 Plus
Dvir\GJ22614-PA 634 GJ22614-PA 6..170 40..200 279 35.5 Plus
Dvir\GJ22612-PA 882 GJ22612-PA 2..150 72..216 206 32.9 Plus
Dvir\GJ22615-PA 851 GJ22615-PA 5..108 113..214 188 37.5 Plus
Dvir\GJ22611-PA 116 GJ22611-PA 1..110 63..172 172 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10904-PA 1042 GK10904-PA 25..202 40..216 372 39.9 Plus
Dwil\GK10902-PA 813 GK10902-PA 6..178 40..215 226 30 Plus
Dwil\GK10903-PA 729 GK10903-PA 1..143 75..216 209 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24222-PA 233 GE24222-PA 16..233 15..232 1013 89 Plus
Dyak\GE10056-PA 1028 GE10056-PA 33..212 37..216 330 38.9 Plus
Dyak\GE10053-PA 847 GE10053-PA 7..193 40..197 179 26.7 Plus
Dyak\GE10052-PA 860 GE10052-PA 12..195 40..197 173 26.5 Plus