Clone FI08035 Report

Search the DGRC for FI08035

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:35
Vector:pOTB7
Associated Gene/TranscriptCG11145-RA
Protein status:FI08035.pep: gold
Sequenced Size:598

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11145 2008-08-15 Release 5.9 accounting
CG11145 2008-12-18 5.12 accounting

Clone Sequence Records

FI08035.complete Sequence

598 bp assembled on 2008-07-24

GenBank Submission: BT032667

> FI08035.complete
AATTCAATTCAAAATTTACAAAATTCTTCGTAAAAAGAATATGCACAAGA
CCTGGAATAAGGCGTTCCACAAGCGCAAGCTGTGGAGGAGCGTGTCCAAG
CCCGGAAAGTTGGTGTACTACATGCAGCCGCTAATCGAGCACTTGTTCGA
CACCTGGATGCAACCACTGCCCTTTCCGACGCTCCTCAAGTTCATCTACA
GCTGGGTGCTGATCTTCTTCATCATGATTCCGATGCTCTATCCGCTGCTC
GTCCTCCTCTCCTACTACGGCATATTCCAGTACGCGGCGGAGGAGCACTT
CGGACTGAAGACGCCCGAGAAGTGGGACCTCCTGGGCGCCGCCGCCAGGC
TGTGGCACTTCGAGGTGACCAACAGGAAGTATCTCCTTCGACTATATGCG
CATGGCTCTGTGGTTCGTCTTCAACTGAACCAACAGCCGGAGTCCTTCGA
TCCCTACTTGCGAATCCCGTTTGCGGGGGAGTTGGCTTAGTAACTGCCTT
TGGAGTGGATAATTTTAGGTCTTTGGGTGGAAGTGTTTCGTACGAAGAAC
TTAACCAATTAAAAGTTGAGCTGTAAAAAAAAAAAAAAAAAAAAAAAA

FI08035.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG11145-RA 801 CG11145-RA 47..621 1..575 2830 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3315496..3315801 387..82 1500 99.3 Minus
chr2R 21145070 chr2R 3315250..3315436 574..388 935 100 Minus
chr2R 21145070 chr2R 3315857..3315938 82..1 410 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:56:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7428151..7428456 387..82 1500 99.3 Minus
2R 25286936 2R 7427904..7428091 575..388 940 100 Minus
2R 25286936 2R 7428512..7428593 82..1 395 98.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7429350..7429655 387..82 1500 99.3 Minus
2R 25260384 2R 7429103..7429290 575..388 940 100 Minus
2R 25260384 2R 7429711..7429792 82..1 395 98.7 Minus
Blast to na_te.dros performed on 2019-03-15 20:56:32 has no hits.

FI08035.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:57:50 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3315250..3315436 388..574 100 <- Minus
chr2R 3315496..3315800 83..387 99 <- Minus
chr2R 3315857..3315938 1..82 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:40 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..450 41..490 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:28 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..450 41..490 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:31:55 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..450 41..490 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:26 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..450 41..490 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:38:08 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..450 41..490 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:27 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..574 1..574 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:28 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..574 1..574 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:31:55 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..574 1..574 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:45:54 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..574 1..574 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:38:08 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
CG11145-RA 1..574 1..574 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:50 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7427905..7428091 388..574 100 <- Minus
2R 7428151..7428455 83..387 99 <- Minus
2R 7428512..7428593 1..82 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:50 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7427905..7428091 388..574 100 <- Minus
2R 7428151..7428455 83..387 99 <- Minus
2R 7428512..7428593 1..82 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:57:50 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7427905..7428091 388..574 100 <- Minus
2R 7428151..7428455 83..387 99 <- Minus
2R 7428512..7428593 1..82 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:31:55 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3315410..3315596 388..574 100 <- Minus
arm_2R 3315656..3315960 83..387 99 <- Minus
arm_2R 3316017..3316098 1..82 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:13 Download gff for FI08035.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7429350..7429654 83..387 99 <- Minus
2R 7429711..7429792 1..82 98   Minus
2R 7429104..7429290 388..574 100 <- Minus

FI08035.hyp Sequence

Translation from 1 to 489

> FI08035.hyp
IQFKIYKILRKENMHKTWNKAFHKRKLWRSVSKPGKLVYYMQPLIEHLFD
TWMQPLPFPTLLKFIYSWVLIFFIMIPMLYPLLVLLSYYGIFQYAAEEHF
GLKTPEKWDLLGAAARLWHFEVTNRKYLLRLYAHGSVVRLQLNQQPESFD
PYLRIPFAGELA*

FI08035.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG11145-PA 149 CG11145-PA 1..149 14..162 811 100 Plus

FI08035.pep Sequence

Translation from 1 to 489

> FI08035.pep
IQFKIYKILRKKNMHKTWNKAFHKRKLWRSVSKPGKLVYYMQPLIEHLFD
TWMQPLPFPTLLKFIYSWVLIFFIMIPMLYPLLVLLSYYGIFQYAAEEHF
GLKTPEKWDLLGAAARLWHFEVTNRKYLLRLYAHGSVVRLQLNQQPESFD
PYLRIPFAGELA*

FI08035.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11954-PA 148 GF11954-PA 1..144 14..158 418 62.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10752-PA 148 GG10752-PA 1..141 14..155 565 74.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20738-PA 148 GH20738-PA 1..144 14..158 366 51 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11145-PA 149 CG11145-PA 1..149 14..162 811 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20821-PA 148 GI20821-PA 1..144 14..158 411 51.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10933-PA 148 GL10933-PA 1..118 14..133 373 56.7 Plus
Dper\GL13675-PA 150 GL13675-PA 1..126 14..139 362 53.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24538-PA 148 GA24538-PA 1..118 14..133 373 56.7 Plus
Dpse\GA26988-PA 150 GA26988-PA 1..116 14..127 361 56.9 Plus
Dpse\GA22396-PA 90 GA22396-PA 1..63 14..76 173 49.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20798-PA 148 GM20798-PA 1..144 14..158 616 81.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10260-PA 192 GD10260-PA 43..188 12..158 626 81.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20554-PA 148 GJ20554-PA 1..144 14..158 412 51.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22014-PA 148 GK22014-PA 1..144 14..158 393 50.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24047-PA 148 GE24047-PA 1..144 14..158 577 75.2 Plus