Clone FI08039 Report

Search the DGRC for FI08039

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:39
Vector:pOTB7
Associated Gene/TranscriptCG15605-RA
Protein status:FI08039.pep: gold
Sequenced Size:636

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15605 2008-08-15 Release 5.9 accounting
CG15605 2008-12-18 5.12 accounting

Clone Sequence Records

FI08039.complete Sequence

636 bp assembled on 2008-07-25

GenBank Submission: BT032668

> FI08039.complete
CAGAAACCCAGGCAAAGCAAAAAATTTTCCAAAAGAAATAGGCAAAATTC
AAAATTACCGGAGGATGGCGCAAAGGGAACGGAAGGCAGGAGTTGTAAAG
AGGGACAAGGCAGATAAGTGGAACCATGTAGAGACGGCTCGATACTTTAG
GGATTTGCAGGAAAATGAGGTGCGAACGATGCATTATTTGGGGCTGGCCT
ACGTGGTTTTGTCTCGTCGCCCAAATTTGCAATTGAAAGTTCCACTGTCC
ACTCAAAACTATGAAGATGGAGCCATTGTGGGAGCAGGGGAGCGAGGAGG
CTATGCCCTCCAGTTGCTCTTCACCTGTGCTGCGAACTATCCACTCGCAA
GGCCGCTGGTGGAGATCGTGGAGAAGCGCAATGTGAGCGACGCCTTTGAG
CAGGTTCTCCGCAAAGAGATTGACCTGATTTTGGAGGAACATCTTGGCCT
CCAGATGATTGTGCCGGTGGTGACCCGGCTGCAAATCACGCTGAATACCG
AGATGAAAAGGCAGCGCTTTTAAGTAAGGTCACGCATAAGTTGTTTTTTG
CCATATTATGCGTAACAATTATTTGTGGTCAATTTTAAGTACAATAAAAT
TTAGCATTTTCCATAAAAAAAAAAAAAAAAAAAAAA

FI08039.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15605-RA 617 CG15605-RA 1..617 1..617 2980 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:25:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13013612..13014225 614..1 3055 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17126407..17127023 617..1 2980 98.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17127606..17128222 617..1 2980 98.8 Minus
Blast to na_te.dros performed on 2019-03-16 21:25:45 has no hits.

FI08039.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:26:55 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13013612..13014225 1..614 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:41 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:41 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:55:40 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:53 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:18:41 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..459 65..523 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:00 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..614 1..614 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:41 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..614 1..614 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:55:40 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..614 1..614 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:10 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..614 1..614 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:18:41 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
CG15605-RA 1..614 1..614 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:26:55 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17126410..17127023 1..614 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:26:55 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17126410..17127023 1..614 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:26:55 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17126410..17127023 1..614 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:55:40 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13013915..13014528 1..614 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:31 Download gff for FI08039.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17127609..17128222 1..614 98   Minus

FI08039.pep Sequence

Translation from 1 to 522

> FI08039.pep
RNPGKAKNFPKEIGKIQNYRRMAQRERKAGVVKRDKADKWNHVETARYFR
DLQENEVRTMHYLGLAYVVLSRRPNLQLKVPLSTQNYEDGAIVGAGERGG
YALQLLFTCAANYPLARPLVEIVEKRNVSDAFEQVLRKEIDLILEEHLGL
QMIVPVVTRLQITLNTEMKRQRF*

FI08039.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13420-PA 192 GF13420-PA 47..187 31..170 510 66.7 Plus
Dana\GF18889-PA 246 GF18889-PA 2..117 46..165 168 32.2 Plus
Dana\GF11441-PA 144 GF11441-PA 1..127 40..171 135 30.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22214-PA 148 GG22214-PA 1..146 22..171 569 74.7 Plus
Dere\GG12365-PA 244 GG12365-PA 2..125 46..173 171 29.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20340-PA 141 GH20340-PA 19..140 46..171 336 54.8 Plus
Dgri\GH20879-PA 141 GH20879-PA 18..140 45..171 334 54.3 Plus
Dgri\GH18921-PA 247 GH18921-PA 2..127 46..172 171 30 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG15605-PA 152 CG15605-PA 1..152 22..173 771 100 Plus
CG5515-PD 244 CG5515-PD 2..125 46..173 159 30.2 Plus
CG5515-PC 244 CG5515-PC 2..125 46..173 159 30.2 Plus
CG5515-PB 244 CG5515-PB 2..125 46..173 159 30.2 Plus
CG5515-PA 244 CG5515-PA 2..125 46..173 159 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21001-PA 136 GI21001-PA 21..134 50..169 340 57.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17262-PA 163 GL17262-PA 31..154 38..167 394 59.2 Plus
Dper\GL24135-PA 244 GL24135-PA 2..117 46..165 165 30.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13843-PA 163 GA13843-PA 31..154 38..167 394 59.2 Plus
Dpse\GA18941-PA 244 GA18941-PA 2..117 46..165 165 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20002-PA 152 GM20002-PA 1..152 22..173 766 94.7 Plus
Dsec\GM23504-PA 244 GM23504-PA 2..125 46..173 174 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25492-PA 152 GD25492-PA 1..152 22..173 757 94.1 Plus
Dsim\GD18314-PA 244 GD18314-PA 2..125 46..173 174 31.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20714-PA 136 GJ20714-PA 5..136 35..171 377 55.8 Plus
Dvir\GJ14527-PA 247 GJ14527-PA 2..127 46..172 161 28.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18885-PA 140 GK18885-PA 10..138 39..173 421 59.3 Plus
Dwil\GK11717-PA 244 GK11717-PA 2..117 46..165 165 30.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14211-PA 152 GE14211-PA 1..152 22..173 607 76.3 Plus
Dyak\GE10819-PA 244 GE10819-PA 2..125 46..173 162 28.7 Plus

FI08039.hyp Sequence

Translation from 1 to 522

> FI08039.hyp
RIPGKANNFPKEIGKIQNYRRMAQRERKAGVVKRDKADKWNHVETARYFR
DLQENEVRTMHYLGLAYVVLSRRPNLQLKVPLSTQNYEDGAIVGAGERGG
YALQLLFTCAANYPLARPLVEIVEKRNVSDAFEQVLRKEIDLILEEHLGL
QMIVPVVTRLQITLNTEMKRQRF*

FI08039.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG15605-PA 152 CG15605-PA 1..152 22..173 771 100 Plus
CG5515-PD 244 CG5515-PD 2..125 46..173 159 30.2 Plus
CG5515-PC 244 CG5515-PC 2..125 46..173 159 30.2 Plus
CG5515-PB 244 CG5515-PB 2..125 46..173 159 30.2 Plus
CG5515-PA 244 CG5515-PA 2..125 46..173 159 30.2 Plus