Clone FI08040 Report

Search the DGRC for FI08040

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:40
Vector:pOTB7
Associated Gene/TranscriptDic3-RA
Protein status:FI08040.pep: gold
Sequenced Size:1020

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11196 2008-08-15 Release 5.9 accounting
CG11196 2008-12-18 5.12 accounting

Clone Sequence Records

FI08040.complete Sequence

1020 bp assembled on 2008-07-15

GenBank Submission: BT044377.1

> FI08040.complete
AGGGTTTCTAAAAAAAAATTCCAAGAAATTAAGTTCGGTCTATGGGAGAA
GACAGTTCGAGGCGCCTCCCGCGCTGGTGGTTTGGAGGGGTTTGCGCTGC
AATCGCAGTCACCGGCACCCATCCGATTGATCTCATCAAGGTACAGCTGC
AGACCCAATCCCAAGCGGACCGGAAGACCGTGGGGGAGATCCTTAAAGGC
ATACACGAGCGGAGCGGAATCTTGGGCTTTTACAATGGCATTTCGGCCTC
CTGGTTTCGCCAGCTGACCTATACCACCACTCGCTTCGCCTTGTACGAGG
CCGGTAAGGACTACGTCGACACGCAAAAAGTTAGTTCCAAGATGGCCCTG
GCCACCTTTGCGGGAATCGTCGGTGGGATTGTGGGTGTACCCGGGGACGT
GGTCACAGTGCGACTCCAGAACGACGTCAAGTTGCCGGAGGAGAAGCGAC
GTAACTACAAGCACGTTTTCGACGGCCTTTTCCGCATCTACAAAGAGGAG
GGCGTGTCCAGTCTCTTCCGCGGCACAGTGCCGGCCGTTTCCAGGGCAGT
CCTGCTGACCATCGGAACGAATGCAGCCTACGACCAAGTAAAGCAGATGC
TCAAGATCGCAACGGGGGCAGGAGAGGGAGTACCACTGCACTTTGCCACA
TCCACGATAGCTGGATGCATTGCCGTGGTGATAACGCAGCCGCTCGATGT
GATCAAGACGACTTTCATGAACGCCCAGCCGGGGGAGTTCTCCGGGATCG
GAGGTGCTTTTCTGAGTACCGCCAAACAGGGCCCATTGGCCTTCTACAAG
GGATTCATTCCGGCCCTGATACGAGTGTCACCCAATACGATTATCACCTT
CGTTTTGTACGAGCAGGCGCGAATGCGATTTGGATATCTGCCACCTGACA
AGTAGGGATGCCCCAAAATTCGTATCCATTTGGCATTTTTACATAAATTG
TATTTTATACACGTGATTTGAAAATATAGAATCTTTCATACCAGACCATT
GAAAAAAAAAAAAAAAAAAA

FI08040.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11196-RA 1046 CG11196-RA 29..1031 1..1003 5015 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3881221..3881767 1001..455 2735 100 Minus
chr2R 21145070 chr2R 3881938..3882391 454..1 2255 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:58:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7993796..7994344 1003..455 2745 100 Minus
2R 25286936 2R 7994515..7994968 454..1 2270 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7994995..7995543 1003..455 2745 100 Minus
2R 25260384 2R 7995714..7996167 454..1 2270 100 Minus
Blast to na_te.dros performed on 2019-03-16 11:58:08 has no hits.

FI08040.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:59:02 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3881221..3881767 455..1001 100 <- Minus
chr2R 3881938..3882391 1..454 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:42 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG11196-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:30 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG11196-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:49:38 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
Dic3-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:52:54 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG11196-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:32:01 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
Dic3-RA 1..864 42..905 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:28:31 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG11196-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:30 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG11196-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:49:38 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
Dic3-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:52:55 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
CG11196-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:32:01 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
Dic3-RA 1..1001 1..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:02 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7993798..7994344 455..1001 100 <- Minus
2R 7994515..7994968 1..454 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:02 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7993798..7994344 455..1001 100 <- Minus
2R 7994515..7994968 1..454 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:59:02 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7993798..7994344 455..1001 100 <- Minus
2R 7994515..7994968 1..454 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:49:38 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3881303..3881849 455..1001 100 <- Minus
arm_2R 3882020..3882473 1..454 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:11 Download gff for FI08040.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7995714..7996167 1..454 100   Minus
2R 7994997..7995543 455..1001 100 <- Minus

FI08040.hyp Sequence

Translation from 41 to 904

> FI08040.hyp
MGEDSSRRLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI
LKGIHERSGILGFYNGISASWFRQLTYTTTRFALYEAGKDYVDTQKVSSK
MALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIY
KEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLH
FATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLA
FYKGFIPALIRVSPNTIITFVLYEQARMRFGYLPPDK*

FI08040.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dic3-PA 287 CG11196-PA 1..287 1..287 1474 100 Plus
Dic1-PC 280 CG8790-PC 6..279 8..283 730 51.4 Plus
Dic1-PA 280 CG8790-PA 6..279 8..283 730 51.4 Plus
Dic1-PB 280 CG8790-PB 6..279 8..283 730 51.4 Plus
Dic3-PB 170 CG11196-PB 1..136 1..136 703 100 Plus

FI08040.pep Sequence

Translation from 41 to 904

> FI08040.pep
MGEDSSRRLPRWWFGGVCAAIAVTGTHPIDLIKVQLQTQSQADRKTVGEI
LKGIHERSGILGFYNGISASWFRQLTYTTTRFALYEAGKDYVDTQKVSSK
MALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEEKRRNYKHVFDGLFRIY
KEEGVSSLFRGTVPAVSRAVLLTIGTNAAYDQVKQMLKIATGAGEGVPLH
FATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGGAFLSTAKQGPLA
FYKGFIPALIRVSPNTIITFVLYEQARMRFGYLPPDK*

FI08040.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:59:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11222-PA 288 GF11222-PA 7..288 5..286 1199 77 Plus
Dana\GF17597-PA 308 GF17597-PA 1..283 1..287 673 47 Plus
Dana\GF17595-PA 263 GF17595-PA 6..259 8..282 659 45.8 Plus
Dana\GF23207-PA 310 GF23207-PA 12..291 5..287 653 47.3 Plus
Dana\GF10808-PA 301 GF10808-PA 24..295 10..281 575 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:59:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10687-PA 288 GG10687-PA 1..287 1..287 1297 88.9 Plus
Dere\GG19610-PA 280 GG19610-PA 6..279 8..283 744 51.8 Plus
Dere\GG15457-PA 304 GG15457-PA 12..291 5..287 662 47.7 Plus
Dere\GG15727-PA 300 GG15727-PA 19..292 8..281 601 42.7 Plus
Dere\GG13673-PA 328 GG13673-PA 53..322 10..283 479 37 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15856-PA 287 GH15856-PA 1..283 1..285 1110 71.6 Plus
Dgri\GH19040-PA 288 GH19040-PA 2..278 5..283 733 48.4 Plus
Dgri\GH18903-PA 316 GH18903-PA 6..297 3..275 428 32.9 Plus
Dgri\GH15793-PA 310 GH15793-PA 16..291 11..275 421 33.7 Plus
Dgri\GH11017-PA 333 GH11017-PA 45..326 19..278 311 29.8 Plus
Dgri\GH11017-PA 333 GH11017-PA 133..309 4..168 147 26.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dic3-PA 287 CG11196-PA 1..287 1..287 1474 100 Plus
Dic1-PC 280 CG8790-PC 6..279 8..283 730 51.4 Plus
Dic1-PA 280 CG8790-PA 6..279 8..283 730 51.4 Plus
Dic1-PB 280 CG8790-PB 6..279 8..283 730 51.4 Plus
Dic3-PB 170 CG11196-PB 1..136 1..136 703 100 Plus
Dic2-PC 304 CG4323-PC 12..291 5..287 693 48.2 Plus
Dic2-PA 304 CG4323-PA 12..291 5..287 693 48.2 Plus
Dic4-PC 302 CG18363-PC 20..292 9..281 588 42.9 Plus
Dic4-PA 302 CG18363-PA 20..292 9..281 588 42.9 Plus
CG1907-PA 317 CG1907-PA 20..299 11..275 409 33.3 Plus
CG18418-PA 311 CG18418-PA 21..292 15..275 397 33.9 Plus
CG7514-PA 301 CG7514-PA 19..291 15..283 390 30.8 Plus
CG6893-PB 250 CG6893-PB 22..244 59..283 388 37 Plus
Bmcp-PB 303 CG7314-PB 12..301 14..277 296 30.9 Plus
Bmcp-PA 303 CG7314-PA 12..301 14..277 296 30.9 Plus
Ucp4A-PB 340 CG6492-PB 49..336 17..281 278 27 Plus
Ucp4A-PA 340 CG6492-PA 49..336 17..281 278 27 Plus
Dic4-PB 173 CG18363-PB 20..147 9..136 264 40.8 Plus
Ucp4B-PA 337 CG18340-PA 44..329 14..277 254 27.5 Plus
sea-PE 317 CG6782-PE 40..306 15..274 248 28.8 Plus
sea-PD 317 CG6782-PD 40..306 15..274 248 28.8 Plus
sea-PC 317 CG6782-PC 40..306 15..274 248 28.8 Plus
sea-PA 317 CG6782-PA 40..306 15..274 248 28.8 Plus
Ucp4C-PA 335 CG9064-PA 47..327 19..277 245 27.1 Plus
CG18327-PB 304 CG18327-PB 9..292 15..275 219 25.3 Plus
CG18327-PA 304 CG18327-PA 9..292 15..275 219 25.3 Plus
colt-PD 306 CG3057-PD 24..305 14..286 219 28.2 Plus
colt-PA 306 CG3057-PA 24..305 14..286 219 28.2 Plus
MME1-PA 299 CG3476-PA 9..287 3..270 215 29 Plus
CG18324-PB 307 CG18324-PB 9..292 15..275 215 24.3 Plus
CG8323-PA 303 CG8323-PA 9..292 15..275 203 26.1 Plus
CG5646-PA 303 CG5646-PA 14..291 14..276 188 26 Plus
Tpc2-PB 323 CG2857-PB 16..311 15..287 188 23.5 Plus
CG16736-PA 277 CG16736-PA 17..268 26..273 187 25 Plus
CG32103-PD 350 CG32103-PD 52..346 12..281 186 23.7 Plus
CG32103-PC 363 CG32103-PC 65..359 12..281 186 23.7 Plus
CG32103-PE 583 CG32103-PE 285..579 12..281 186 23.7 Plus
CG32103-PB 583 CG32103-PB 285..579 12..281 186 23.7 Plus
PMP34-PB 314 CG32250-PB 22..310 15..283 183 23.4 Plus
PMP34-PA 314 CG32250-PA 22..310 15..283 183 23.4 Plus
aralar1-PB 679 CG2139-PB 329..604 11..280 178 25.9 Plus
aralar1-PD 682 CG2139-PD 332..607 11..280 178 25.9 Plus
aralar1-PA 682 CG2139-PA 332..607 11..280 178 25.9 Plus
aralar1-PF 694 CG2139-PF 332..607 11..280 178 25.9 Plus
aralar1-PC 695 CG2139-PC 345..620 11..280 178 25.9 Plus
aralar1-PE 707 CG2139-PE 357..632 11..280 178 25.9 Plus
Tpc1-PA 332 CG6608-PA 35..328 15..277 164 22.7 Plus
Tpc1-PB 332 CG6608-PB 35..328 15..277 164 22.7 Plus
CG18324-PA 199 CG18324-PA 2..184 106..275 160 24.6 Plus
Ucp4B-PA 337 CG18340-PA 148..330 15..185 159 25.4 Plus
CG5254-PB 237 CG5254-PB 59..224 16..174 156 28.1 Plus
CG5254-PA 306 CG5254-PA 128..293 16..174 156 28.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:59:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12639-PA 273 GI12639-PA 1..264 21..286 1036 72.2 Plus
Dmoj\GI24334-PA 280 GI24334-PA 2..277 5..282 709 47.8 Plus
Dmoj\GI10541-PA 289 GI10541-PA 4..287 5..287 664 44.2 Plus
Dmoj\GI11313-PA 254 GI11313-PA 1..252 34..286 485 43 Plus
Dmoj\GI12576-PA 310 GI12576-PA 16..291 11..275 440 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10604-PA 290 GL10604-PA 1..286 1..286 1155 71.3 Plus
Dper\GL24469-PA 282 GL24469-PA 3..279 5..283 748 50.2 Plus
Dper\GL24092-PA 299 GL24092-PA 14..291 7..287 689 47 Plus
Dper\GL22710-PA 295 GL22710-PA 18..293 11..287 544 39.5 Plus
Dper\GL22891-PA 314 GL22891-PA 30..306 5..282 538 38.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10831-PA 290 GA10831-PA 1..286 1..286 1153 71.3 Plus
Dpse\GA21325-PA 282 GA21325-PA 3..279 5..283 748 50.2 Plus
Dpse\GA18108-PA 299 GA18108-PA 14..291 7..287 690 47 Plus
Dpse\GA23392-PA 295 GA23392-PA 18..293 11..287 540 39.5 Plus
Dpse\GA19935-PA 321 GA19935-PA 35..313 3..282 537 38.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20734-PA 287 GM20734-PA 1..287 1..287 1455 95.8 Plus
Dsec\GM24103-PA 280 GM24103-PA 5..279 7..283 737 51.3 Plus
Dsec\GM23191-PA 304 GM23191-PA 12..291 5..287 697 47.5 Plus
Dsec\GM14924-PA 302 GM14924-PA 20..295 9..284 603 43.1 Plus
Dsec\GM12797-PA 317 GM12797-PA 20..299 11..275 432 33.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:59:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10201-PA 287 GD10201-PA 1..287 1..287 1482 97.2 Plus
Dsim\GD18902-PA 280 GD18902-PA 5..279 7..283 741 51.3 Plus
Dsim\GD20064-PA 304 GD20064-PA 12..291 5..287 702 47.9 Plus
Dsim\GD12330-PA 302 GD12330-PA 20..295 9..284 603 43.1 Plus
Dsim\GD21444-PA 317 GD21444-PA 20..299 11..275 432 33.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12758-PA 286 GJ12758-PA 1..284 1..286 1112 71 Plus
Dvir\GJ10419-PA 288 GJ10419-PA 9..278 11..282 701 49.3 Plus
Dvir\GJ24196-PA 283 GJ24196-PA 6..282 7..286 630 46.1 Plus
Dvir\GJ11569-PA 302 GJ11569-PA 16..298 3..284 566 40.7 Plus
Dvir\GJ13745-PA 296 GJ13745-PA 15..293 7..286 498 35.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21563-PA 291 GK21563-PA 2..283 3..286 1104 70.1 Plus
Dwil\GK13938-PA 282 GK13938-PA 2..279 4..283 757 50.4 Plus
Dwil\GK22729-PA 314 GK22729-PA 6..289 2..287 726 50 Plus
Dwil\GK11904-PA 326 GK11904-PA 28..307 11..275 435 34.3 Plus
Dwil\GK10769-PA 165 GK10769-PA 4..159 128..282 361 44.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23410-PA 287 GE23410-PA 1..287 1..287 1352 90.2 Plus
Dyak\GE26266-PA 280 GE26266-PA 5..279 7..283 733 50.5 Plus
Dyak\GE11146-PA 304 GE11146-PA 12..291 5..287 705 48.1 Plus
Dyak\GE25074-PA 304 GE25074-PA 12..291 5..287 705 48.1 Plus
Dyak\GE22058-PA 300 GE22058-PA 20..292 9..281 600 44.2 Plus