Clone FI08041 Report

Search the DGRC for FI08041

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:41
Vector:pOTB7
Associated Gene/TranscriptCG3215-RA
Protein status:FI08041.pep: gold
Sequenced Size:1217

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3215 2008-08-15 Release 5.9 accounting
CG3215 2008-12-18 5.12 accounting

Clone Sequence Records

FI08041.complete Sequence

1217 bp assembled on 2008-08-14

GenBank Submission: BT044378.1

> FI08041.complete
CAAACACGAAACATTTGATTGAAATTCATACATCATTTGGCAATCTCCAA
CTCAAGATGGACAAGATAATGATTTGCATCATTGGGTCGGGAAACTGGGC
CACTACCATAGCCCGCAATGTGGGCAGAAACGTGCTGAATTCGCAGACAC
TGGACGAAAAGGTGCCCATGTACGTTTATGAGGAAATTGTTGAAGGTCGC
AAGCTCACGGAAATCATCAACACCACCCACATAAATTCCAAGTACATGCC
GAACTTTGAACTGCCGCCAAATATTGTGGCCGTGGATGATATCGTGACTA
CGGCTCGAGATGCGGACATTATAATATTCGCCATTCCGCCGACTTTCGTG
AGTAGCTGCTGCAAGACGCTGCTCGGAAAAGTCAAGCCCACGGCCCACGC
CGTTTCCCTGATCAAAGGATTCGAGCGCGGCGACGATGGCCAGTTCGTCC
TGATTTCGCAGATTATAATGCGGCAGCTAAAGATTCCCTGCTCCGTCCTG
GTCGGCTGTAACTTGGCCCATGAGCTGGCCCACGACCACTTTGCCGAGGG
CACAGTTGGCTGTCGGGATCAGAAGTATTACAGGGTGCTCCACGACATAT
TCAAGTCGCCCACTTTCCGCGTGGTGGTCACCGAGGATGCCGACTGTGTG
GAGATCTGTTCCACTCTAAGGAACATCATTGCCTTTGCGGCTGGCTGTTC
CGACGGGATGGAGCTGAATGAGAACACCAAGGGAGGCATCATCAGGAGAG
GATTTCTGGAGATGCTTCAGTTCGTCGATGTGTTCTATCCCGGCTGCCGC
ATGGGAACCTTTTTTGAGTCGTGCGGAATATCCGATTTGGTTACTAGTTG
TTATGCAAACCGCAATCGCAAGTTGGCCGAAGCTTTTGTGAAGACGGGCA
AACCCTTGAGCGAACTGGAGCACATTCTCATTCCAGGACACGAGCCACTG
GGTCCGGTGACAGCGGAGCTGGTGCATCATATGCTCAAGAAGAAGGGCTT
GGAGGACAAATTCCCCCTCTTTACAACTGTGTACAGAATCTGCACTGGAG
ACTATCCACTGCAGCGTCTGGTCGAAACTCTGATTAAGGCACGCGAGGAT
ATATTTCACCCGCTCCATACTTTCCAATTGTGAAGCAGCGGACTCGTCGT
TTAAGGTGTAATAAGTTTTAAATAAATACATATAAGCATCAGCAAAAAAA
AAAAAAAAAAAAAAAAA

FI08041.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG3215-RA 1280 CG3215-RA 81..1274 1..1194 5850 99.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19016345..19016623 279..1 1365 99.3 Minus
chr2R 21145070 chr2R 19016077..19016283 482..276 1020 99.5 Minus
chr2R 21145070 chr2R 19015807..19015997 671..481 940 99.5 Minus
chr2R 21145070 chr2R 19015564..19015748 855..671 910 99.5 Minus
chr2R 21145070 chr2R 19015356..19015510 1009..855 775 100 Minus
chr2R 21145070 chr2R 19015202..19015298 1102..1006 470 99 Minus
chr2R 21145070 chr2R 19015053..19015143 1193..1103 455 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:38:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23129895..23130173 279..1 1335 98.6 Minus
2R 25286936 2R 23129627..23129833 482..276 1020 99.5 Minus
2R 25286936 2R 23129357..23129547 671..481 955 100 Minus
2R 25286936 2R 23129114..23129298 855..671 895 98.9 Minus
2R 25286936 2R 23128906..23129060 1009..855 775 100 Minus
2R 25286936 2R 23128603..23128694 1194..1103 460 100 Minus
2R 25286936 2R 23128752..23128848 1102..1006 455 97.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23131094..23131372 279..1 1335 98.5 Minus
2R 25260384 2R 23130826..23131032 482..276 1020 99.5 Minus
2R 25260384 2R 23130556..23130746 671..481 955 100 Minus
2R 25260384 2R 23130313..23130497 855..671 895 98.9 Minus
2R 25260384 2R 23130105..23130259 1009..855 775 100 Minus
2R 25260384 2R 23129802..23129893 1194..1103 460 100 Minus
2R 25260384 2R 23129951..23130047 1102..1006 455 97.9 Minus
Blast to na_te.dros performed on 2019-03-16 04:38:16 has no hits.

FI08041.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:39:14 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19015807..19015995 483..671 99 <- Minus
chr2R 19016077..19016283 276..482 99 <- Minus
chr2R 19015053..19015143 1103..1193 100 <- Minus
chr2R 19015202..19015294 1010..1102 100 <- Minus
chr2R 19015356..19015509 856..1009 100 <- Minus
chr2R 19015564..19015747 672..855 99 <- Minus
chr2R 19016349..19016623 1..275 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:44 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 1..1077 57..1133 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:06 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 1..1077 57..1133 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:31 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 1..1077 57..1133 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:25 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 1..1077 57..1133 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:46:57 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 1..1077 57..1133 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:09 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 17..1209 1..1193 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:05 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 17..1209 1..1193 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:31 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 17..1209 1..1193 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:29:31 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 17..1209 1..1193 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:46:57 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
CG3215-RA 17..1209 1..1193 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:14 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23129627..23129833 276..482 99 <- Minus
2R 23128604..23128694 1103..1193 100 <- Minus
2R 23128752..23128844 1010..1102 98 <- Minus
2R 23128906..23129059 856..1009 100 <- Minus
2R 23129114..23129297 672..855 98 <- Minus
2R 23129357..23129545 483..671 100 <- Minus
2R 23129899..23130173 1..275 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:14 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23129627..23129833 276..482 99 <- Minus
2R 23128604..23128694 1103..1193 100 <- Minus
2R 23128752..23128844 1010..1102 98 <- Minus
2R 23128906..23129059 856..1009 100 <- Minus
2R 23129114..23129297 672..855 98 <- Minus
2R 23129357..23129545 483..671 100 <- Minus
2R 23129899..23130173 1..275 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:39:14 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23129627..23129833 276..482 99 <- Minus
2R 23128604..23128694 1103..1193 100 <- Minus
2R 23128752..23128844 1010..1102 98 <- Minus
2R 23128906..23129059 856..1009 100 <- Minus
2R 23129114..23129297 672..855 98 <- Minus
2R 23129357..23129545 483..671 100 <- Minus
2R 23129899..23130173 1..275 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:31 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19016880..19017068 483..671 100 <- Minus
arm_2R 19017150..19017356 276..482 99 <- Minus
arm_2R 19016127..19016217 1103..1193 100 <- Minus
arm_2R 19016275..19016367 1010..1102 98 <- Minus
arm_2R 19016429..19016582 856..1009 100 <- Minus
arm_2R 19016637..19016820 672..855 98 <- Minus
arm_2R 19017422..19017696 1..275 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:17 Download gff for FI08041.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23130844..23131050 276..482 99 <- Minus
2R 23131116..23131390 1..275 98   Minus
2R 23130123..23130276 856..1009 100 <- Minus
2R 23129821..23129911 1103..1193 100 <- Minus
2R 23129969..23130061 1010..1102 98 <- Minus
2R 23130331..23130514 672..855 98 <- Minus
2R 23130574..23130762 483..671 100 <- Minus

FI08041.pep Sequence

Translation from 2 to 1132

> FI08041.pep
NTKHLIEIHTSFGNLQLKMDKIMICIIGSGNWATTIARNVGRNVLNSQTL
DEKVPMYVYEEIVEGRKLTEIINTTHINSKYMPNFELPPNIVAVDDIVTT
ARDADIIIFAIPPTFVSSCCKTLLGKVKPTAHAVSLIKGFERGDDGQFVL
ISQIIMRQLKIPCSVLVGCNLAHELAHDHFAEGTVGCRDQKYYRVLHDIF
KSPTFRVVVTEDADCVEICSTLRNIIAFAAGCSDGMELNENTKGGIIRRG
FLEMLQFVDVFYPGCRMGTFFESCGISDLVTSCYANRNRKLAEAFVKTGK
PLSELEHILIPGHEPLGPVTAELVHHMLKKKGLEDKFPLFTTVYRICTGD
YPLQRLVETLIKAREDIFHPLHTFQL*

FI08041.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13315-PA 358 GF13315-PA 1..358 19..376 1838 95 Plus
Dana\Gpdh-PA 360 GF15589-PA 3..343 20..360 978 53.7 Plus
Dana\GF18443-PA 1391 GF18443-PA 3..338 20..360 598 34.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20063-PA 358 GG20063-PA 1..358 19..376 1911 99.4 Plus
Dere\Gpdh-PA 360 GG25104-PA 3..343 20..360 983 54 Plus
Dere\GG11128-PA 1272 GG11128-PA 4..342 21..360 665 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23061-PA 359 GH23061-PA 3..359 20..376 1556 79.3 Plus
Dgri\GH11012-PA 360 GH11012-PA 3..343 20..360 972 54 Plus
Dgri\GH20384-PA 349 GH20384-PA 7..342 24..360 704 39.5 Plus
Dgri\GH13333-PA 1631 GH13333-PA 7..342 24..360 683 39.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:31
Subject Length Description Subject Range Query Range Score Percent Strand
Gpdh2-PA 358 CG3215-PA 1..358 19..376 1885 100 Plus
Gpdh1-PE 350 CG9042-PE 3..343 20..360 1025 54 Plus
Gpdh1-PA 350 CG9042-PA 3..343 20..360 1025 54 Plus
Gpdh1-PG 353 CG9042-PG 3..343 20..360 1025 54 Plus
Gpdh1-PC 353 CG9042-PC 3..343 20..360 1025 54 Plus
Gpdh1-PF 360 CG9042-PF 3..343 20..360 1025 54 Plus
Gpdh1-PB 360 CG9042-PB 3..343 20..360 1025 54 Plus
Gpdh3-PC 1303 CG43343-PC 4..342 21..360 655 37.6 Plus
Gpdh3-PA 1304 CG31169-PB 4..342 21..360 655 37.6 Plus
Gpdh3-PB 1291 CG31169-PC 4..311 21..329 596 38.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21131-PA 359 GI21131-PA 3..359 20..376 1596 81.8 Plus
Dmoj\GI17532-PA 360 GI17532-PA 3..343 20..360 977 54 Plus
Dmoj\GI22380-PA 1383 GI22380-PA 7..342 24..360 683 40.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11294-PA 389 GL11294-PA 26..389 15..376 1675 87.4 Plus
Dper\Gpdh-PA 360 GL19044-PA 3..343 20..360 975 53.7 Plus
Dper\GL24207-PA 1442 GL24207-PA 4..343 21..360 712 39.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16715-PA 360 GA16715-PA 3..360 20..376 1676 88 Plus
Dpse\GA16060-PC 1457 GA16060-PC 4..343 21..360 740 39.7 Plus
Dpse\GA16060-PB 1628 GA16060-PB 187..514 33..360 695 39 Plus
Dpse\GA25323-PA 75 GA25323-PA 3..74 20..91 224 52.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15578-PA 358 GM15578-PA 1..358 19..376 1907 99.4 Plus
Dsec\GM26425-PA 119 GM26425-PA 4..96 21..113 206 43.6 Plus
Dsec\GM18581-PA 84 GM18581-PA 3..71 20..88 205 50.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25078-PA 358 GD25078-PA 1..358 19..376 1914 99.7 Plus
Dsim\Gpdh-PA 360 GD23370-PA 3..343 20..360 982 54 Plus
Dsim\GD20943-PA 1130 GD20943-PA 4..342 21..360 659 37.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20981-PA 359 GJ20981-PA 3..359 20..376 1630 82.6 Plus
Dvir\Gpdh-PA 360 GJ15413-PA 3..343 20..360 966 53.4 Plus
Dvir\GJ15418-PA 288 GJ15418-PA 3..271 92..360 753 54.3 Plus
Dvir\GJ24413-PA 957 GJ24413-PA 7..342 24..360 654 38 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19593-PA 358 GK19593-PA 1..358 19..376 1667 86 Plus
Dwil\Gpdh-PA 360 GK14706-PA 3..343 20..360 963 53.7 Plus
Dwil\GK14264-PA 1646 GK14264-PA 1..341 19..360 786 43.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11600-PA 358 GE11600-PA 1..358 19..376 1907 99.2 Plus
Dyak\Gpdh-PA 360 GE25734-PA 3..343 20..360 982 54 Plus
Dyak\GE10294-PA 1278 GE10294-PA 4..342 21..360 678 37.6 Plus

FI08041.hyp Sequence

Translation from 2 to 1132

> FI08041.hyp
NTKHLIEIHTSFGNLQLKMDKIMICIIGSGNWATTIARNVGRNVLNSQTL
DEKVPMYVYEEIVEGRKLTEIINTTHINSKYMPNFELPPNIVAVDDIVTT
ARDADIIIFAIPPTFVSSCCKTLLGKVKPTAHAVSLIKGFERGDDGQFVL
ISQIIMRQLKIPCSVLVGCNLAHELAHDHFAEGTVGCRDQKYYRVLHDIF
KSPTFRVVVTEDADCVEICSTLRNIIAFAAGCSDGMELNENTKGGIIRRG
FLEMLQFVDVFYPGCRMGTFFESCGISDLVTSCYANRNRKLAEAFVKTGK
PLSELEHILIPGHEPLGPVTAELVHHMLKKKGLEDKFPLFTTVYRICTGD
YPLQRLVETLIKAREDIFHPLHTFQL*

FI08041.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG3215-PA 358 CG3215-PA 1..358 19..376 1885 100 Plus
Gpdh-PE 350 CG9042-PE 3..343 20..360 1025 54 Plus
Gpdh-PA 350 CG9042-PA 3..343 20..360 1025 54 Plus
Gpdh-PG 353 CG9042-PG 3..343 20..360 1025 54 Plus
Gpdh-PC 353 CG9042-PC 3..343 20..360 1025 54 Plus