Clone FI08046 Report

Search the DGRC for FI08046

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:46
Vector:pOTB7
Associated Gene/TranscriptCG16852-RA
Protein status:FI08046.pep: gold
Sequenced Size:852

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG16852 2008-08-15 Release 5.9 accounting
CG16852 2008-12-18 5.12 accounting

Clone Sequence Records

FI08046.complete Sequence

852 bp assembled on 2008-07-28

GenBank Submission: BT044382.1

> FI08046.complete
GAAAACATATTGAATCACAAAGGCAAGGAGCGACTAGAAGAACTCTACAT
GCTTAGTTCAAAAAGTGACACTTCTGGAGACGATATCTCTATAACTGCAC
AAGCAGAAAAAAGAGTGGATGATAGCATCAGAGCGCCATCTATTGGCTGG
AATGCTGAGCACAAAGATGTTCAGATTCCAAGGGACCAACTAACCCACAG
GCAGATCAGCAAGTGCAATTTGTTTGAGGAATACATCAAGCTCCCAAAGA
GTGAATATGGACAAACAAGCCGCATGAAGCGATTCCGATCCGAAGAGTTA
GCTATTAAGCAAGAAGATCAAATCGTGGAGCATAGATCATCGAGTCTTTC
GCGGCTATCGGATGTCACAATCAAGCCCACCTGCGAGGTGAGTAGTCAGA
CTTCGTGGACAGCAGCGGACGAGAGTAATATGAATAGCAAGGATTTGGAG
GCGAAGCTGGCGGCTGTACGCGGCGGTGGTATCGATCTCGAAACGGACAA
GCCCAGCAAGATCCAGCAGCACACGATCCACATCGAGGTGGAGTCGGTGA
CATCGGCCACGGCTATGCAAAGACCCCCACTGCACCAAAGGATGTGGCAG
GTCCTTGTGCAGACGGCGGATACGATTGTCGCATTCGCCTCTATAATCGG
CGAGAATTTAACAGTGGCACTCTTCATTGTCCTGTGCCTGTGGTGCCTTT
ACCTCTTACTAAGCCACTTTTATGGCAACTTGCAGACCAATGTCGGCATG
CCGTCCAAATAATTGTAATAAGAATGATTCGTTTTGCACGTGATTGTATG
AGTAAAAATGCAGTAAACAGAATTAGCAGAACAGAAAAAAAAAAAAAAAA
AA

FI08046.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG16852-RA 959 CG16852-RA 126..959 2..835 4170 100 Plus
CG16852.a 880 CG16852.a 50..880 2..835 4100 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13539805..13540327 312..834 2615 100 Plus
chr2L 23010047 chr2L 13539434..13539745 2..313 1560 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13541124..13541647 312..835 2620 100 Plus
2L 23513712 2L 13540753..13541064 2..313 1560 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13541124..13541647 312..835 2620 100 Plus
2L 23513712 2L 13540753..13541064 2..313 1560 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:30:56 has no hits.

FI08046.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:31:51 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13539432..13539745 1..313 99 -> Plus
chr2L 13539807..13540327 314..834 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:53 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..714 49..762 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:06 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..714 49..762 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:58:46 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..714 49..762 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:10 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..714 49..762 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:33 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..714 49..762 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:21 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..835 1..834 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:06 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..835 1..834 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:58:46 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..835 1..834 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:19 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..835 1..834 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:33 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
CG16852-RA 1..835 1..834 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:51 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13540751..13541064 1..313 99 -> Plus
2L 13541126..13541646 314..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:51 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13540751..13541064 1..313 99 -> Plus
2L 13541126..13541646 314..834 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:31:51 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13540751..13541064 1..313 99 -> Plus
2L 13541126..13541646 314..834 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:58:46 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13540751..13541064 1..313 99 -> Plus
arm_2L 13541126..13541646 314..834 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:23 Download gff for FI08046.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13540751..13541064 1..313 99 -> Plus
2L 13541126..13541646 314..834 100   Plus

FI08046.pep Sequence

Translation from 0 to 761

> FI08046.pep
ENILNHKGKERLEELYMLSSKSDTSGDDISITAQAEKRVDDSIRAPSIGW
NAEHKDVQIPRDQLTHRQISKCNLFEEYIKLPKSEYGQTSRMKRFRSEEL
AIKQEDQIVEHRSSSLSRLSDVTIKPTCEVSSQTSWTAADESNMNSKDLE
AKLAAVRGGGIDLETDKPSKIQQHTIHIEVESVTSATAMQRPPLHQRMWQ
VLVQTADTIVAFASIIGENLTVALFIVLCLWCLYLLLSHFYGNLQTNVGM
PSK*

FI08046.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23338-PA 285 GF23338-PA 1..270 17..249 536 48.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23865-PA 254 GG23865-PA 1..233 17..248 833 76.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25004-PA 263 GH25004-PA 58..254 56..253 316 38.2 Plus
Dgri\GH25134-PA 259 GH25134-PA 58..254 56..253 316 38.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG16852-PA 237 CG16852-PA 1..237 17..253 1209 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19967-PA 291 GI19967-PA 71..277 56..249 308 36.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26070-PA 236 GL26070-PA 19..223 21..240 349 39.9 Plus
Dper\GL25697-PA 198 GL25697-PA 1..197 18..234 241 34.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25268-PA 236 GA25268-PA 19..223 21..240 349 39.1 Plus
Dpse\GA25397-PA 203 GA25397-PA 1..202 18..234 246 36 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10630-PA 245 GM10630-PA 1..232 17..249 949 87.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23909-PA 245 GD23909-PA 1..231 17..248 942 87.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13395-PA 293 GJ13395-PA 34..270 47..249 310 33.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15275-PA 263 GK15275-PA 30..243 40..249 386 41.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18668-PA 240 GE18668-PA 1..223 17..249 836 76.4 Plus

FI08046.hyp Sequence

Translation from 1 to 761

> FI08046.hyp
KNILNHKGKERLEELYMLSSKSDTSGDDISITAQAEKRVDDSIRAPSIGW
NAEHKDVQIPRDQLTHRQISKCNLFEEYIKLPKSEYGQTSRMKRFRSEEL
AIKQEDQIVEHRSSSLSRLSDVTIKPTCEVSSQTSWTAADESNMNSKDLE
AKLAAVRGGGIDLETDKPSKIQQHTIHIEVESVTSATAMQRPPLHQRMWQ
VLVQTADTIVAFASIIGENLTVALFIVLCLWCLYLLLSHFYGNLQTNVGM
PSK*

FI08046.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG16852-PA 237 CG16852-PA 1..237 17..253 1209 100 Plus