Clone FI08048 Report

Search the DGRC for FI08048

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:48
Vector:pOTB7
Associated Gene/TranscriptCG1409-RB
Protein status:FI08048.pep: gold
Sequenced Size:661

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1409 2008-08-15 Release 5.9 accounting
CG1409 2008-12-18 5.12 accounting

Clone Sequence Records

FI08048.complete Sequence

661 bp assembled on 2008-07-24

GenBank Submission: BT032669

> FI08048.complete
ATGATTTCGGAGATCTCTACACAATCGCGAGCAAAATTCCCTTTAGACAA
GCAGAAAATGGCACGGTACTTAGCGCAAATCATCATTTTGGGTGCCCAGC
TGGTTGGCCGGGCGCTGGTAAAGACGATGCGCCAGGAGCTGCAGGCCTTC
GAGGATGCGGCACGCCTTCAGGAAACGCTAAAGGCCAACGATCCCAACAG
CGGCAGGAGTGCGGTGGCCAAGACAATGACCCTGGCGGAGGCCCAGCAGA
TTCTCGATGTGAGTGACCTTACCAACCGCCAAGCGATAGATACGCACTAC
CAGCACTTGTTTCGTGTGAACGACAAATCCACCGGCGGTAGCTTCTACAT
TCAGTCGAAAGTCTTTCGGGCCAAGGAGCGAATCGATCAGGAACTGGAAC
GGACGGAGCTGTTGGTCAAGACCGACGACTCCCATTCAATCCTACCAACG
CCACCGGAATCCTCGCAATTCCAATGCGAGAACAAAGAGCCGGGTCAGAA
GAGCCGATGATCCTTCGCAGCTGTATTCACATGGATTGCCTTTTAGTAGC
GTGGCATAAAATCGTCTTCGAACTTTTTGTACATGTATATATTTAAATCG
TCAATTAAATAGTTTGATATGCAAAAAAAAAAAAAAAAAAAATAAAAAAA
AAAAAAAAAAA

FI08048.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG1409.a 622 CG1409.a 1..622 1..622 3065 99.5 Plus
CG1409-RB 622 CG1409-RB 1..622 1..622 3065 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:32:53
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7750112..7750738 1..627 3120 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:32:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7858173..7858799 1..627 3090 99.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7866271..7866897 1..627 3090 99.5 Plus
Blast to na_te.dros performed on 2019-03-15 16:32:52 has no hits.

FI08048.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:33:52 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7750112..7750733 1..622 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:55 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..453 58..510 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:02:34 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..453 58..510 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:18:24 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..453 58..510 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:21 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..453 58..510 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:42 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..453 58..510 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:21:44 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..622 1..622 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:02:34 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..622 1..622 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:18:24 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..622 1..622 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-25 13:46:15 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..622 1..622 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:42 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
CG1409-RB 1..622 1..622 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:52 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
X 7858173..7858794 1..622 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:52 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
X 7858173..7858794 1..622 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:33:52 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
X 7858173..7858794 1..622 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:18:24 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7752206..7752827 1..622 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:30:21 Download gff for FI08048.complete
Subject Subject Range Query Range Percent Splice Strand
X 7866271..7866892 1..622 99   Plus

FI08048.pep Sequence

Translation from 0 to 509

> FI08048.pep
MISEISTQSRAKFPLDKQKMARYLAQIIILGAQLVGRALVKTMRQELQAF
EDAARLQETLKANDPNSGRSAVAKTMTLAEAQQILDVSDLTNRQAIDTHY
QHLFRVNDKSTGGSFYIQSKVFRAKERIDQELERTELLVKTDDSHSILPT
PPESSQFQCENKEPGQKSR*

FI08048.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21248-PA 148 GF21248-PA 1..112 20..132 375 63.7 Plus
Dana\GF18551-PA 142 GF18551-PA 1..111 20..131 317 55.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19662-PA 151 GG19662-PA 1..151 20..169 579 77.5 Plus
Dere\GG16964-PA 141 GG16964-PA 1..116 20..136 299 51.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23473-PA 136 GH23473-PA 1..113 20..133 317 52.6 Plus
Dgri\GH12586-PA 209 GH12586-PA 1..115 20..136 306 55.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG1409-PB 150 CG1409-PB 1..150 20..169 749 100 Plus
blp-PB 141 CG5268-PB 1..116 20..136 305 55.6 Plus
blp-PA 141 CG5268-PA 1..116 20..136 305 55.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22953-PA 138 GI22953-PA 1..132 20..154 310 46.7 Plus
Dmoj\GI16335-PA 171 GI16335-PA 1..113 20..133 300 54.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22082-PA 137 GL22082-PA 1..113 20..133 314 55.3 Plus
Dper\GL14729-PA 129 GL14729-PA 1..117 20..136 307 50.4 Plus
Dper\GL14733-PA 129 GL14733-PA 1..115 20..134 302 50.4 Plus
Dper\GL14731-PA 129 GL14731-PA 1..117 20..136 301 49.6 Plus
Dper\GL14593-PA 129 GL14593-PA 1..129 20..146 276 45 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18774-PA 137 GA18774-PA 1..113 20..133 314 55.3 Plus
Dpse\GA26184-PA 127 GA26184-PA 1..117 20..136 308 50.4 Plus
Dpse\GA24125-PA 127 GA24125-PA 1..117 20..136 308 50.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24271-PA 141 GM24271-PA 1..133 20..154 321 51.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16862-PA 150 GD16862-PA 1..150 20..169 700 87.3 Plus
Dsim\GD19059-PA 141 GD19059-PA 1..116 20..136 317 55.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15903-PA 135 GJ15903-PA 1..130 20..151 324 51.5 Plus
Dvir\GJ23769-PA 139 GJ23769-PA 1..116 20..136 307 52.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18836-PA 135 GK18836-PA 1..114 20..134 313 54.8 Plus
Dwil\GK11218-PA 135 GK11218-PA 1..113 20..133 307 51.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:48:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15737-PA 157 GE15737-PA 1..157 20..169 561 72 Plus
Dyak\GE24352-PA 141 GE24352-PA 1..116 20..136 317 55.6 Plus

FI08048.hyp Sequence

Translation from 1 to 509

> FI08048.hyp
MISEISTQSRAKFPLDKQKMARYLAQIIILGAQLVGRALVKTMRQELQAF
EDAARLQETLKANDPNSGRSAVAKTMTLAEAQQILDVSDLTNRQAIDTHY
QHLFRVNDKSTGGSFYIQSKVFRAKERIDQELERTELLVKTDDSHSILPT
PPESSQFQCENKEPGQKSR*

FI08048.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG1409-PB 150 CG1409-PB 1..150 20..169 749 100 Plus
blp-PB 141 CG5268-PB 1..116 20..136 305 55.6 Plus
blp-PA 141 CG5268-PA 1..116 20..136 305 55.6 Plus