Clone FI08055 Report

Search the DGRC for FI08055

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:55
Vector:pOTB7
Associated Gene/TranscriptCG31347-RA
Protein status:FI08055.pep: gold
Sequenced Size:887

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31347 2008-08-15 Release 5.9 accounting
CG31347 2008-12-18 5.12 accounting

Clone Sequence Records

FI08055.complete Sequence

887 bp assembled on 2008-07-29

GenBank Submission: BT044385.1

> FI08055.complete
ATTTTATTTAAAATTCAACGTGCAAACAGGAAATCTATATAGTCAACATG
GAATCCTTTAGTGTGCCGGAAGTGGACATGATGACCGTGTCAAAGAATTC
GCAATACGAACGGGAATCGCTACTAAAGTTCGCACCGCCAGTTGGACTGA
CCAACATCAGCTACGGCAGCTTGTACAAGGTGGACTCCTTCTATTTGGAG
TGCCAGAAGTACCGAGATCAATTCCGCGATCCCTACAACAAGCTGCTGCG
CCCCAAGATGTTCAGCACATACAGGGGCAAGTGTGGTGTGAAGATAGATC
CCGAACTGGAGCGCTTAAAGCGACCCGCTGCCTCCCATGTGGAGTCTATT
CCCGTGGTTTACCCAATGGAGTACGGGCACCAAATGGACTTCGACAGAGG
CTTCCAGATGCAGGGACGCAACAGCAGGGATGCAGCCACCGCCCGCAGAT
ATCCGTGTGTGCGTGTGCTGGGCAGATAAAGGGATTCCACGCAAGCTTTA
TAGACCAAATTCCCCGTTTTCGCTGTCTTCACTTCCGAATTGAACCATCT
CTGGCGTTTGCGGAGCTATTCTCTCTGGGATTAGTCATGTTGGCCATTTG
AAGACGGCTTGAAAGCTCGTTGACAAAGGGACGGGCGGTAGGTGATGTCA
CTGTTTGCTGGCTAAAACTTTGGGAACCCTAGATTTGCACAAAGCTACCC
GCATTTAATGAGCCCCATCTCCACTTACGTTATCTATGACGACGGGCTGG
TTGACGACGACATCATAAGGCTCCATTTTGTGCGTTTATCAAAATTTGCA
AATTTTCTATTAAATAGTTGGTCAACAGGGTGACCGTAGGTGGTTGGCAG
AAATAAACAGCATGTAAAAAAAAAAAAAAAAAAAAAA

FI08055.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG31347-RA 865 CG31347-RA 1..865 1..865 4325 100 Plus
Arp87C-RA 1543 Arp87C-RA 1..139 866..728 695 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8516974..8517838 865..1 4310 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12691728..12692597 870..1 4350 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12432559..12433428 870..1 4350 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:37:01 has no hits.

FI08055.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:37:41 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8516974..8517838 1..865 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:57:58 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..432 48..479 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:26 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..432 48..479 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:26 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..432 48..479 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:32 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..432 48..479 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:08:47 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..432 48..479 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:38 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..615 1..615 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:26 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..865 1..865 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:26 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..865 1..865 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:19:59 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..615 1..615 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:08:47 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
CG31347-RA 1..865 1..865 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:37:41 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12691733..12692597 1..865 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:37:41 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12691733..12692597 1..865 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:37:41 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12691733..12692597 1..865 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:26 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8517455..8518319 1..865 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:43 Download gff for FI08055.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12432564..12433428 1..865 100   Minus

FI08055.pep Sequence

Translation from 47 to 478

> FI08055.pep
MESFSVPEVDMMTVSKNSQYERESLLKFAPPVGLTNISYGSLYKVDSFYL
ECQKYRDQFRDPYNKLLRPKMFSTYRGKCGVKIDPELERLKRPAASHVES
IPVVYPMEYGHQMDFDRGFQMQGRNSRDAATARRYPCVRVLGR*

FI08055.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17873-PA 136 GF17873-PA 1..134 1..134 477 64.9 Plus
Dana\GF22722-PA 133 GF22722-PA 3..125 6..127 274 46 Plus
Dana\GF15522-PA 140 GF15522-PA 9..109 6..106 268 44.6 Plus
Dana\GF17872-PA 135 GF17872-PA 5..126 6..126 262 41 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17104-PA 143 GG17104-PA 1..143 1..143 723 93.7 Plus
Dere\GG25343-PA 134 GG25343-PA 3..113 6..117 268 44.6 Plus
Dere\GG17102-PA 135 GG17102-PA 3..132 4..132 259 37.7 Plus
Dere\GG25288-PA 1312 GG25288-PA 6..103 6..101 253 43.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19560-PA 135 GH19560-PA 1..132 1..132 286 41.7 Plus
Dgri\GH13601-PA 137 GH13601-PA 1..115 1..115 255 36.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG31347-PA 143 CG31347-PA 1..143 1..143 758 100 Plus
CG13110-PA 133 CG13110-PA 3..113 6..117 262 44.6 Plus
CG14391-PA 135 CG14391-PA 3..132 4..132 262 38.5 Plus
CG43796-PA 127 CG43796-PA 1..96 11..106 249 44.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17431-PA 137 GI17431-PA 1..133 1..131 288 39.8 Plus
Dmoj\GI22263-PA 135 GI22263-PA 1..132 1..132 274 38.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26142-PA 133 GL26142-PA 3..130 6..132 304 45.7 Plus
Dper\GL26141-PA 133 GL26141-PA 1..116 4..120 295 44.4 Plus
Dper\GL23114-PA 123 GL23114-PA 1..120 11..132 219 44.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25300-PA 138 GA25300-PA 4..136 3..135 328 45.9 Plus
Dpse\GA12052-PA 133 GA12052-PA 3..130 6..132 304 45.7 Plus
Dpse\GA28678-PA 133 GA28678-PA 3..130 6..132 304 45.7 Plus
Dpse\GA25307-PA 133 GA25307-PA 1..116 4..120 296 44.4 Plus
Dpse\GA27147-PB 132 GA27147-PB 5..129 6..132 222 43.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25988-PA 143 GM25988-PA 1..143 1..143 757 99.3 Plus
Dsec\GM17435-PA 133 GM17435-PA 3..113 6..117 267 44.6 Plus
Dsec\GM25986-PA 135 GM25986-PA 3..132 4..132 257 38.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20548-PA 143 GD20548-PA 1..143 1..143 762 100 Plus
Dsim\GD23598-PA 133 GD23598-PA 3..113 6..117 267 44.6 Plus
Dsim\GD20547-PA 135 GD20547-PA 3..132 4..132 264 39.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24054-PA 135 GJ24054-PA 1..132 1..132 296 41.7 Plus
Dvir\GJ18378-PA 137 GJ18378-PA 1..120 1..122 280 40.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18959-PA 128 GK18959-PA 2..125 5..132 257 43 Plus
Dwil\GK24173-PA 1339 GK24173-PA 1..74 11..84 243 51.4 Plus
Dwil\GK24199-PA 134 GK24199-PA 3..123 6..124 198 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24493-PA 143 GE24493-PA 1..143 1..143 726 93.7 Plus
Dyak\GE18835-PA 133 GE18835-PA 3..113 6..117 272 45.5 Plus
Dyak\GE18778-PA 137 GE18778-PA 6..106 6..106 268 46.5 Plus
Dyak\GE24492-PA 135 GE24492-PA 3..132 4..132 262 38.5 Plus

FI08055.hyp Sequence

Translation from 47 to 478

> FI08055.hyp
MESFSVPEVDMMTVSKNSQYERESLLKFAPPVGLTNISYGSLYKVDSFYL
ECQKYRDQFRDPYNKLLRPKMFSTYRGKCGVKIDPELERLKRPAASHVES
IPVVYPMEYGHQMDFDRGFQMQGRNSRDAATARRYPCVRVLGR*

FI08055.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:40:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG31347-PA 143 CG31347-PA 1..143 1..143 758 100 Plus
CG13110-PA 133 CG13110-PA 3..113 6..117 262 44.6 Plus
CG14391-PA 135 CG14391-PA 3..132 4..132 262 38.5 Plus
CG43796-PA 127 CG43796-PA 1..96 11..106 249 44.8 Plus