Clone FI08064 Report

Search the DGRC for FI08064

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:80
Well:64
Vector:pOTB7
Associated Gene/TranscriptCG31787-RA
Protein status:FI08064.pep: gold
Sequenced Size:846

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31787 2008-12-18 5.12 accounting

Clone Sequence Records

FI08064.complete Sequence

846 bp assembled on 2008-08-25

GenBank Submission: BT044389.1

> FI08064.complete
GTCGAACAATTCGAGTCGTAAAATTGGAAAAGCGTCGGAAAATGTTCCGA
ATCGCTCGTGTTATTTGGCTGCTGCAGTTGCTGCTGCTGTTGGATCTCAA
ATTTTCCAACGCCGAGCCGCACAACAAACAACTGACTGTATTCGCGGAAG
CTGGTCGACAGGAGTGCTTTTATCAGCCGATTGCCACCACCGAGAACATT
AAAATCGACTATCAGGTGATACATGGAGGTCTCGGCGAGACACACATCAA
TTTTAATCTTATGGATCCAAGTCGTCGACTTCTGATAGCAGAAACCAAAA
GGCAAATGGGGAAACACAGCATTCAGGCTAACGAAACTGGTTCTTATAAG
TTTTGCTTCGATAATACCATCAGCACTTTTAACCAAAAGATAGTTTCGTT
TACTCTTGAAGTAGCTCCGGCCGATCGAGAAGAGCGGGAATTGCGTGATC
TTCGCCAGGAAATGTTAACCGACTACCACTTTGACGTGGCCTATACTGGT
ATCGATAGTTACGTGGGCAAGATCCATGTGAACCTCATGAGATCGCGTCA
AACTCAGGACTTCATTCGAGCGATCGAGGCCAGGGATCGCAACGTGGCCG
AATCCACCTACTCCATGGTCAACAAATGGTCGTGGGCCCAATTTTTGTCC
ATGATATTTGTTGGCTTTCTACAGGTCTTGATGGTCAGGAGTATTTTTAA
TACGACTGGAACGTTTTACAAGTTTTGGAAAAGTTTTTAAGCTTCAGCCC
TGTAAGATTGAAAGAAAATGATTTATCAGGGCTTGCAGACTGGAAAATAA
ATATAAGTATAGGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

FI08064.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG31787-RA 840 CG31787-RA 10..774 1..765 3810 99.8 Plus
CG31787.a 786 CG31787.a 348..720 393..765 1850 99.7 Plus
CG31787.a 786 CG31787.a 10..352 1..343 1700 99.7 Plus
CG31787-RA 840 CG31787-RA 791..840 765..814 250 100 Plus
CG31787.a 786 CG31787.a 737..786 765..814 250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:56:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18283542..18284372 814..1 3865 98 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:32 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18284842..18285675 817..1 3865 97.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18284911..18285675 765..1 3810 99.8 Minus
2L 23513712 2L 18284842..18284894 817..765 265 100 Minus
Blast to na_te.dros performed 2019-03-16 16:56:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6794..6833 92..54 134 85 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1563..1625 92..32 121 68.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6530..6582 95..47 119 77.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2777..2829 105..54 118 71.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2297..2335 102..64 114 76.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2632..2681 91..41 108 70.6 Minus

FI08064.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:57:42 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18283542..18283589 767..814 100 <- Minus
chr2L 18283608..18284372 1..766 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:08 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 1..699 42..740 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:11:36 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 1..699 42..740 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:09 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 1..699 42..740 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:19:51 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 1..699 42..740 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:48:44 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 1..699 42..740 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 02:08:50 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 10..749 1..740 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:11:35 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 10..774 1..766 99 -> Plus
CG31787-RA 793..840 767..814 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:09 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 10..774 1..766 99 -> Plus
CG31787-RA 793..840 767..814 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-28 18:05:35 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 10..749 1..740 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:48:44 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
CG31787-RA 46..810 1..766 99 -> Plus
CG31787-RA 829..876 767..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:42 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18284845..18284892 767..814 100 <- Minus
2L 18284911..18285675 1..766 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:42 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18284845..18284892 767..814 100 <- Minus
2L 18284911..18285675 1..766 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:42 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18284845..18284892 767..814 100 <- Minus
2L 18284911..18285675 1..766 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:09 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18284845..18284892 767..814 100 <- Minus
arm_2L 18284911..18285675 1..766 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:41:52 Download gff for FI08064.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18284911..18285675 1..766 99   Minus
2L 18284845..18284892 767..814 100 <- Minus

FI08064.pep Sequence

Translation from 2 to 739

> FI08064.pep
RTIRVVKLEKRRKMFRIARVIWLLQLLLLLDLKFSNAEPHNKQLTVFAEA
GRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPSRRLLIAETKR
QMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDL
RQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAE
STYSMVNKWSWAQFLSMIFVGFLQVLMVRSIFNTTGTFYKFWKSF*

FI08064.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14850-PA 230 GF14850-PA 1..230 14..245 826 64.2 Plus
Dana\GF22070-PA 235 GF22070-PA 3..233 21..245 420 37.9 Plus
Dana\GF19355-PA 208 GF19355-PA 27..202 46..232 165 23.5 Plus
Dana\GF19411-PA 226 GF19411-PA 47..213 53..232 163 27.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:22:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21711-PA 229 GG21711-PA 1..229 14..245 1091 90.1 Plus
Dere\GG19424-PA 242 GG19424-PA 26..240 36..245 432 40.4 Plus
Dere\GG18829-PA 210 GG18829-PA 31..197 53..232 162 27.8 Plus
Dere\GG18710-PA 208 GG18710-PA 27..202 46..232 159 23 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:22:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11207-PA 244 GH11207-PA 27..234 35..242 688 60.6 Plus
Dgri\GH11950-PA 209 GH11950-PA 1..207 44..245 416 38.5 Plus
Dgri\GH24063-PA 209 GH24063-PA 28..203 46..232 162 24.1 Plus
Dgri\GH11947-PA 238 GH11947-PA 59..225 53..232 161 27.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG31787-PA 232 CG31787-PA 1..232 14..245 1206 100 Plus
opm-PA 242 CG9053-PA 11..238 20..243 427 38.8 Plus
opm-PC 242 CG9053-PC 11..238 20..243 427 38.8 Plus
p24-1-PB 210 CG1967-PB 32..197 54..232 170 28.5 Plus
p24-1-PA 210 CG1967-PA 32..197 54..232 170 28.5 Plus
CHOp24-PB 208 CG3564-PB 5..202 17..232 166 23.6 Plus
CHOp24-PA 208 CG3564-PA 5..202 17..232 166 23.6 Plus
loj-PF 237 CG10733-PF 1..227 6..232 145 20.8 Plus
loj-PE 237 CG10733-PE 1..227 6..232 145 20.8 Plus
loj-PD 237 CG10733-PD 1..227 6..232 145 20.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18130-PA 232 GI18130-PA 1..232 14..245 735 60.3 Plus
Dmoj\GI15367-PA 241 GI15367-PA 31..239 40..245 417 36.8 Plus
Dmoj\GI15363-PA 235 GI15363-PA 15..222 8..232 180 27.1 Plus
Dmoj\GI15191-PA 208 GI15191-PA 22..202 41..232 162 23.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19428-PA 226 GL19428-PA 3..226 19..245 763 61.2 Plus
Dper\GL26847-PA 238 GL26847-PA 28..236 40..245 412 38.1 Plus
Dper\GL19967-PA 208 GL19967-PA 27..202 46..232 163 24.1 Plus
Dper\GL20350-PA 221 GL20350-PA 42..208 53..232 154 26.7 Plus
Dper\GL15550-PA 238 GL15550-PA 51..230 46..234 152 22.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16477-PA 226 GA16477-PA 18..226 37..245 769 65.6 Plus
Dpse\GA21505-PA 238 GA21505-PA 28..236 40..245 399 37.1 Plus
Dpse\GA28584-PA 208 GA28584-PA 27..202 46..232 165 24.1 Plus
Dpse\GA10530-PA 238 GA10530-PA 51..230 46..234 152 22.2 Plus
Dpse\GA15160-PA 221 GA15160-PA 42..208 53..232 151 26.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:22:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17092-PA 232 GM17092-PA 1..232 14..245 1135 94 Plus
Dsec\GM12010-PA 242 GM12010-PA 26..240 36..245 422 39.4 Plus
Dsec\GM12348-PA 208 GM12348-PA 27..202 46..232 156 23 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21836-PA 232 GD21836-PA 1..232 14..245 1136 94 Plus
Dsim\GD15824-PA 242 GD15824-PA 26..240 36..245 422 39.4 Plus
Dsim\GD16693-PA 208 GD16693-PA 27..202 46..232 156 23 Plus
Dsim\GD13935-PA 237 GD13935-PA 1..227 6..232 155 21.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17754-PA 233 GJ17754-PA 1..231 14..243 720 61.5 Plus
Dvir\GJ16792-PA 242 GJ16792-PA 31..240 41..245 423 38.4 Plus
Dvir\GJ16789-PA 246 GJ16789-PA 67..233 53..232 161 27.8 Plus
Dvir\GJ14798-PA 208 GJ14798-PA 27..202 46..232 160 23.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14577-PA 235 GK14577-PA 1..235 14..245 779 62.6 Plus
Dwil\GK19732-PA 224 GK19732-PA 12..222 40..245 422 38.7 Plus
Dwil\GK14515-PA 299 GK14515-PA 118..293 46..232 153 23.3 Plus
Dwil\GK17263-PA 241 GK17263-PA 54..233 46..234 152 22.2 Plus
Dwil\GK10123-PA 224 GK10123-PA 45..211 53..232 149 26.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:22:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12735-PA 229 GE12735-PA 1..229 14..245 1092 90.5 Plus
Dyak\GE16075-PA 242 GE16075-PA 26..240 36..245 426 39.9 Plus
Dyak\GE17592-PA 210 GE17592-PA 31..197 53..232 163 27.8 Plus
Dyak\GE16348-PA 208 GE16348-PA 5..202 17..232 158 23.1 Plus

FI08064.hyp Sequence

Translation from 2 to 739

> FI08064.hyp
RTIRVVKLEKRRKMFRIARVIWLLQLLLLLDLKFSNAEPHNKQLTVFAEA
GRQECFYQPIATTENIKIDYQVIHGGLGETHINFNLMDPSRRLLIAETKR
QMGKHSIQANETGSYKFCFDNTISTFNQKIVSFTLEVAPADREERELRDL
RQEMLTDYHFDVAYTGIDSYVGKIHVNLMRSRQTQDFIRAIEARDRNVAE
STYSMVNKWSWAQFLSMIFVGFLQVLMVRSIFNTTGTFYKFWKSF*

FI08064.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:40:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG31787-PA 232 CG31787-PA 1..232 14..245 1206 100 Plus
opm-PA 242 CG9053-PA 11..238 20..243 427 38.8 Plus
opm-PC 242 CG9053-PC 11..238 20..243 427 38.8 Plus
p24-1-PB 210 CG1967-PB 32..197 54..232 170 28.5 Plus
p24-1-PA 210 CG1967-PA 32..197 54..232 170 28.5 Plus