Clone FI08136 Report

Search the DGRC for FI08136

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:81
Well:36
Vector:pOTB7
Associated Gene/Transcriptyip3-RA
Protein status:FI08136.pep: gold
Sequenced Size:1175

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
yip3 2008-08-15 Release 5.9 accounting
yip3 2008-12-18 5.12 accounting

Clone Sequence Records

FI08136.complete Sequence

1175 bp assembled on 2008-08-14

GenBank Submission: BT044391.1

> FI08136.complete
CTCTAGTGTGTGTCTTTAAATTGATAGGCTCGTTAAAGTATCTACCATTC
CGAGGCCTTCTGGTCTTGACTTCGCCAACTGGTTGGATCTATTTTTAGGG
CCAGCAGGTGCAGCTGCCTCGGAAACTGCGCAGAGACGCGTTTCTCGGCC
AGTGCCAACCAGTTGGCGAGACCCCATCATCATCATCGCCATCGCCATCT
GAAGATCGCCATCCAGCGTAGGTGACGGACAGCCTCGGGCTGCCAATATC
ACTTACTTTCAGACAATGGATAGCCACACAGGCGTTGACGATTTGTTGGC
CTTAATCTACTTGAGCAAATATTAGTTTTGAAAGGTCTTTGTACCCAGCT
CAAGTTTATTTTCTACTTCCCAAGCCCTTTTAAAGTTTTAAAGAATCTTT
GCAGCTCATTTAACTGGCACTTTTCTGCTCGAACGCTTTTGGGAGTCTAT
TTGAAAATGATGGAAGGTGAAAGTTCTAAGTCGATCCAAGGCAACATCGT
GGGTCTTAAGAGTACCAACGCCGTGATACTGGCCACCGACTCGAAGGAAT
ACGAAATGTATCTAATAGATGACCGCATTTACTGCTGCGCACCTCGTTCC
GGCATCGATCGGAACATAGTTCTGGAAGTGAGTTCAAAGGTGGCAAATCT
AGTCCGGGATCGCGGCCAGAATGTGACCGTGTCCCAGGTGCGGGACATGT
TTTGCGAAAAGTACCAGACCGCCGAATCCCCAAATGTCATGATAGCTGGC
CAGGACAGCAGGGGCCTTCACTTATTCAGCATGGAGTGTGGAAAGTCACG
CATGGTGATGTATGGTGCAAAGGGCAGAGATAAGGAGAACATTGTGGACT
TTCTCTCGAAAGACTGGAATGATTTCATAAACCTCAGCGAGGCTGAACAG
TTGGCCAGGAAAGCGCTTAGGTGGGAGCACGTGGAAATGTGCACCATCTA
TAGGGCTAAAGAAATCGAGGAACAAGGTGCCAACATGGACTTCGATATGG
ACGACGAGACCTCTGTATCGCCGGCCAGCAATTTCTAGATCCTCCTACTA
TCTACATGTACATAGTAGTTAATTGTATCATTTCGATTTATGTTCATATA
AATGAATGGTGGCTGCTCCACTGCCCCCCCCCCCCTGTAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

FI08136.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
yip3-RA 1199 yip3-RA 54..1184 5..1135 5610 99.7 Plus
yip3-RB 1199 yip3-RB 54..1184 5..1135 5610 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:18:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19130429..19130982 1135..582 2770 100 Minus
chr2R 21145070 chr2R 19131198..19131666 473..5 2345 100 Minus
chr2R 21145070 chr2R 19131033..19131142 581..472 520 98.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23244048..23244601 1135..582 2770 100 Minus
2R 25286936 2R 23244817..23245285 473..5 2330 99.8 Minus
2R 25286936 2R 23244652..23244761 581..472 520 98.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23245247..23245800 1135..582 2770 100 Minus
2R 25260384 2R 23246016..23246484 473..5 2330 99.7 Minus
2R 25260384 2R 23245851..23245960 581..472 520 98.1 Minus
Blast to na_te.dros performed on 2019-03-15 21:18:20 has no hits.

FI08136.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:19:27 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19130425..19130982 582..1138 99 <- Minus
chr2R 19131033..19131140 474..581 98 <- Minus
chr2R 19131198..19131667 1..473 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:11 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RB 1..582 457..1038 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:06:53 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RB 1..582 457..1038 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:43:46 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 1..582 457..1038 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:21 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 1..582 457..1038 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:49:16 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 1..582 457..1038 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:31:49 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 2..1136 5..1138 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:06:52 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 2..1136 5..1138 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:43:46 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 112..1249 1..1138 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-14 11:28:33 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 2..1136 5..1138 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:49:16 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
yip3-RA 112..1249 1..1138 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:27 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23244044..23244601 582..1138 99 <- Minus
2R 23244652..23244759 474..581 98 <- Minus
2R 23244817..23245286 1..473 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:27 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23244044..23244601 582..1138 99 <- Minus
2R 23244652..23244759 474..581 98 <- Minus
2R 23244817..23245286 1..473 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:19:27 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23244044..23244601 582..1138 99 <- Minus
2R 23244652..23244759 474..581 98 <- Minus
2R 23244817..23245286 1..473 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:43:46 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19131567..19132124 582..1138 99 <- Minus
arm_2R 19132175..19132282 474..581 98 <- Minus
arm_2R 19132340..19132809 1..473 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:00 Download gff for FI08136.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23245261..23245818 582..1138 99 <- Minus
2R 23245869..23245976 474..581 98 <- Minus
2R 23246034..23246503 1..473 99   Minus

FI08136.pep Sequence

Translation from 456 to 1037

> FI08136.pep
MMEGESSKSIQGNIVGLKSTNAVILATDSKEYEMYLIDDRIYCCAPRSGI
DRNIVLEVSSKVANLVRDRGQNVTVSQVRDMFCEKYQTAESPNVMIAGQD
SRGLHLFSMECGKSRMVMYGAKGRDKENIVDFLSKDWNDFINLSEAEQLA
RKALRWEHVEMCTIYRAKEIEEQGANMDFDMDDETSVSPASNF*

FI08136.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13309-PA 206 GF13309-PA 1..172 1..169 351 42.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:43:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20056-PA 194 GG20056-PA 1..194 1..193 564 55.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
yip3-PB 193 CG13549-PB 1..193 1..193 996 100 Plus
yip3-PA 193 CG13549-PA 1..193 1..193 996 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21124-PA 792 GI21124-PA 23..166 14..154 195 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11287-PA 183 GL11287-PA 9..182 14..180 143 26.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24668-PA 277 GA24668-PA 85..275 3..184 157 27.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15573-PA 193 GM15573-PA 1..193 1..193 862 84.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19047-PA 193 GD19047-PA 1..193 1..193 848 83.4 Plus
Dsim\GD25072-PA 193 GD25072-PA 1..193 1..193 842 83.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:43:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20973-PA 199 GJ20973-PA 25..184 14..166 261 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11593-PA 193 GE11593-PA 1..193 1..193 657 62.9 Plus

FI08136.hyp Sequence

Translation from 456 to 1037

> FI08136.hyp
MMEGESSKSIQGNIVGLKSTNAVILATDSKEYEMYLIDDRIYCCAPRSGI
DRNIVLEVSSKVANLVRDRGQNVTVSQVRDMFCEKYQTAESPNVMIAGQD
SRGLHLFSMECGKSRMVMYGAKGRDKENIVDFLSKDWNDFINLSEAEQLA
RKALRWEHVEMCTIYRAKEIEEQGANMDFDMDDETSVSPASNF*

FI08136.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
yip3-PB 193 CG13549-PB 1..193 1..193 996 100 Plus
yip3-PA 193 CG13549-PA 1..193 1..193 996 100 Plus