Clone FI08137 Report

Search the DGRC for FI08137

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:81
Well:37
Vector:pOTB7
Associated Gene/TranscriptProsbeta5R1-RA
Protein status:FI08137.pep: gold
Sequenced Size:1104

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
Prosbeta5R1 2008-08-15 Release 5.9 accounting
Prosbeta5R1 2008-12-18 5.12 accounting

Clone Sequence Records

FI08137.complete Sequence

1104 bp assembled on 2008-07-15

GenBank Submission: BT044392.1

> FI08137.complete
ACACATTACACTAAACTATTTATTGGAAATAATTAACTCTTTTTGAACAC
ATAATGGCTCTGGAAGCGATTTGCGGCATGAATAAAATGCCTTTTATGCG
GCGCTTCGATGACTTGCAGTCCGAATGGCAGAAGGAGCAGCTTCGCGAGG
CAACCAGTAATTTTGAGAATCCCTACGAACTGATGGCGCCTCCCTTCGAA
AGGCCCGCTGAGAATCTGCCCAAGATCCTGTCGCACTGTGGCATTCGCAT
GGATTTCGATCACGGCACCACCACTCTGGGTTTCAAGTATCGCGGAGGAG
TGATTCTGTGTGCTGATTCTAGGGCCACCTCTGGCCAGTATATTGGATCA
CAGACGATGAGGAAAATAGTCGAGCTGAACGACTATATGCTGGGCACCTT
GGCCGGCGGAGCCGCGGATTGCGTCTACTGGGATCGGGTTTTGGCTAAGG
AGTGTCGCCTGCACCAGCTGCGCTATCGGAAACGCATGACCGTGGACACG
GCTGCCCGGATCATCTGCAACATATCCACGGAGTACAAGGGCATGGGTCT
GGTGATGGGCATGATGCTGGCCGGCTTCGACGACGAGGGACCCAAGCTGA
TTTACGTGGACTCGGAGGGCATGAGATCCCATGGTCAAGTCTTCTCCGTG
GGCAGCGGTTCTCCATATGCGCTCGGCGTATTGGACACTGGGTACCGCTA
TGATCTCTCCGATCAGGAGGCCTATGACCTGGCCAGGCGAGCGATTTACC
ATGCGACCAGTAAGGATGCCTATTCTGGTGGAATCGTGCGTCTCTACCAC
ATTCATTCGGAGGGCTGGCGAAATATCTGCAATACGGACTGCTCCGATCT
CCATGACTCGTATTGCGCATCTGGGTGTCCGGGGAACGAGAAGGATGTAG
GAAACGTAGGCGATCCCGACAATGATAAGCCCTGTTCCAGTGGCTGGACG
AAGAAGAATATCACAGCAGACAATTTGCAGACTAAGCTGGCAACGGTATG
AAAATTTGGAAATTATTGGAGCAACATTAGGAACATATTACCAAAAATTT
CTGTGGAAGTAAAACTTCTGTCGTGCAAAACGTAAAAAAAAAAAAAAAAA
AAAA

FI08137.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:56
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5R-RA 1129 Prosbeta5R-RA 55..1084 1..1030 5060 99.4 Plus
Prosbeta5R-RA 1129 Prosbeta5R-RA 1080..1127 1037..1084 225 97.9 Plus
Prosbeta5-RB 1126 Prosbeta5-RB 371..502 338..469 195 76.5 Plus
Prosbeta5-RA 1199 Prosbeta5-RA 444..575 338..469 195 76.5 Plus
Prosbeta5-RB 1126 Prosbeta5-RB 567..607 534..574 145 90.2 Plus
Prosbeta5-RA 1199 Prosbeta5-RA 640..680 534..574 145 90.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:56:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19195022..19195891 1083..203 4055 97.6 Minus
chr2R 21145070 chr2R 19195948..19196149 202..1 995 99.5 Minus
chr2R 21145070 chr2R 6707962..6708198 338..574 240 73.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23308649..23309523 1088..203 4155 98.2 Minus
2R 25286936 2R 23309580..23309781 202..1 995 99.5 Minus
2R 25286936 2R 10820425..10820661 338..574 240 73.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:22:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23309895..23310722 1030..203 4080 99.5 Minus
2R 25260384 2R 23310779..23310980 202..1 995 99.5 Minus
2R 25260384 2R 23309848..23309899 1088..1037 230 96.1 Minus
2R 25260384 2R 10821624..10821755 338..469 195 76.5 Plus
2R 25260384 2R 10821820..10821860 534..574 145 90.2 Plus
Blast to na_te.dros performed on 2019-03-16 16:56:10 has no hits.

FI08137.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:57:13 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19195022..19195890 204..1083 97 <- Minus
chr2R 19195947..19196149 1..203 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:13 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 1..948 54..1001 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:05:36 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R-RA 1..948 54..1001 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:26:44 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 1..948 54..1001 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-22 00:53:00 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 1..948 54..1001 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:50 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 1..948 54..1001 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:28:43 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 36..1107 1..1083 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:05:36 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R-RA 36..1107 1..1083 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:26:44 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 36..1107 1..1083 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-22 00:53:00 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 36..1107 1..1083 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:50 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
Prosbeta5R1-RA 36..1107 1..1083 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:13 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23308654..23309522 204..1083 98 <- Minus
2R 23309579..23309781 1..203 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:13 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23308654..23309522 204..1083 98 <- Minus
2R 23309579..23309781 1..203 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:57:13 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23308654..23309522 204..1083 98 <- Minus
2R 23309579..23309781 1..203 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:26:44 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19196177..19197045 204..1083 98 <- Minus
arm_2R 19197102..19197304 1..203 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:34:20 Download gff for FI08137.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23310796..23310998 1..203 99   Minus
2R 23309871..23310739 204..1083 98 <- Minus

FI08137.pep Sequence

Translation from 53 to 1000

> FI08137.pep
MALEAICGMNKMPFMRRFDDLQSEWQKEQLREATSNFENPYELMAPPFER
PAENLPKILSHCGIRMDFDHGTTTLGFKYRGGVILCADSRATSGQYIGSQ
TMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECRLHQLRYRKRMTVDTA
ARIICNISTEYKGMGLVMGMMLAGFDDEGPKLIYVDSEGMRSHGQVFSVG
SGSPYALGVLDTGYRYDLSDQEAYDLARRAIYHATSKDAYSGGIVRLYHI
HSEGWRNICNTDCSDLHDSYCASGCPGNEKDVGNVGDPDNDKPCSSGWTK
KNITADNLQTKLATV*

FI08137.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13303-PA 314 GF13303-PA 1..314 1..315 1419 83.2 Plus
Dana\GF13778-PA 284 GF13778-PA 1..272 1..270 903 61.7 Plus
Dana\GF14807-PA 308 GF14807-PA 1..287 1..287 834 51.6 Plus
Dana\GF21399-PA 293 GF21399-PA 1..270 1..270 618 45 Plus
Dana\GF13326-PA 229 GF13326-PA 15..226 71..280 223 29.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:58:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20051-PA 390 GG20051-PA 1..314 1..314 1617 95.2 Plus
Dere\GG20151-PA 282 GG20151-PA 1..269 1..267 902 61.3 Plus
Dere\GG21097-PA 245 GG21097-PA 1..234 37..270 849 62.8 Plus
Dere\GG22308-PA 224 GG22308-PA 15..198 71..254 203 29.2 Plus
Dere\GG11178-PA 322 GG11178-PA 49..225 71..247 202 30.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:58:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23050-PA 315 GH23050-PA 1..306 1..314 1246 72.2 Plus
Dgri\GH20460-PA 280 GH20460-PA 1..269 1..267 899 62.6 Plus
Dgri\GH14538-PA 275 GH14538-PA 1..256 1..270 501 39.1 Plus
Dgri\GH19825-PA 222 GH19825-PA 15..198 71..254 212 30.3 Plus
Dgri\GH16666-PA 272 GH16666-PA 43..232 75..265 188 28.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5R1-PA 315 CG9868-PA 1..315 1..315 1699 100 Plus
Prosbeta5R2-PB 279 CG31742-PB 1..274 1..274 924 58.8 Plus
Prosbeta5R2-PA 279 CG31742-PA 1..274 1..274 924 58.8 Plus
Prosbeta5-PA 282 CG12323-PA 1..272 1..270 882 61.2 Plus
Prosbeta5-PB 282 CG12323-PB 1..272 1..270 882 61.2 Plus
Prosbeta1-PA 224 CG8392-PA 15..198 71..254 210 28.6 Plus
Prosbeta2R2-PA 322 CG12161-PA 46..225 68..247 210 32 Plus
Prosbeta2R1-PA 307 CG18341-PA 48..230 71..254 204 31 Plus
Prosbeta2-PA 272 CG3329-PA 39..214 71..247 195 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21121-PA 314 GI21121-PA 1..306 1..315 1212 70.9 Plus
Dmoj\GI18886-PA 279 GI18886-PA 1..272 1..270 906 62.6 Plus
Dmoj\GI10892-PA 322 GI10892-PA 1..299 1..291 785 48.8 Plus
Dmoj\GI20414-PA 222 GI20414-PA 15..198 71..254 228 31.9 Plus
Dmoj\GI11352-PA 270 GI11352-PA 39..232 71..265 200 29.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:58:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11283-PA 305 GL11283-PA 1..300 1..315 1192 69 Plus
Dper\GL14524-PA 270 GL14524-PA 1..262 1..270 677 47 Plus
Dper\GL21838-PA 312 GL21838-PA 49..230 71..253 197 30.1 Plus
Dper\GL10209-PA 225 GL10209-PA 4..198 65..254 195 29.1 Plus
Dper\GL26231-PA 238 GL26231-PA 21..204 71..254 192 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22086-PA 321 GA22086-PA 1..316 1..315 1292 73.4 Plus
Dpse\GA11556-PA 279 GA11556-PA 1..269 1..267 906 62.6 Plus
Dpse\GA25177-PA 270 GA25177-PA 1..262 1..270 682 47.4 Plus
Dpse\GA26418-PA 312 GA26418-PA 49..230 71..253 199 30.1 Plus
Dpse\GA21041-PA 225 GA21041-PA 4..198 65..254 195 29.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:58:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15565-PA 315 GM15565-PA 1..315 1..315 1635 95.6 Plus
Dsec\GM17255-PA 279 GM17255-PA 1..270 1..270 944 59.3 Plus
Dsec\GM21240-PA 282 GM21240-PA 1..272 1..270 910 61.9 Plus
Dsec\GM12440-PA 307 GM12440-PA 48..230 71..254 199 32.1 Plus
Dsec\GM20098-PA 224 GM20098-PA 15..198 71..254 198 28.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:58:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24120-PA 279 GD24120-PA 1..270 1..270 954 60.4 Plus
Dsim\GD10758-PA 282 GD10758-PA 1..272 1..270 909 61.9 Plus
Dsim\GD25066-PA 114 GD25066-PA 21..114 222..315 454 89.4 Plus
Dsim\GD16756-PA 307 GD16756-PA 48..230 71..254 202 32.6 Plus
Dsim\GD19639-PA 322 GD19639-PA 46..225 68..247 196 32.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20967-PA 312 GJ20967-PA 1..307 1..315 1260 71.8 Plus
Dvir\GJ21921-PA 279 GJ21921-PA 1..272 1..270 920 63.4 Plus
Dvir\GJ16567-PA 328 GJ16567-PA 1..273 1..273 817 51.6 Plus
Dvir\GJ20086-PA 222 GJ20086-PA 15..198 71..254 206 30.8 Plus
Dvir\GJ11606-PA 270 GJ11606-PA 41..230 75..265 182 28.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:58:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19557-PA 362 GK19557-PA 1..310 1..313 1272 71.8 Plus
Dwil\GK15836-PA 283 GK15836-PA 1..272 1..270 913 61.2 Plus
Dwil\GK18059-PA 311 GK18059-PA 1..269 1..270 759 50.4 Plus
Dwil\GK25153-PA 353 GK25153-PA 50..221 71..242 206 32.9 Plus
Dwil\GK21488-PA 225 GK21488-PA 14..197 71..254 203 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11586-PA 315 GE11586-PA 1..315 1..315 1591 93.7 Plus
Dyak\Prosbeta5-PA 282 GE12841-PA 1..269 1..267 913 62 Plus
Dyak\GE12802-PA 246 GE12802-PA 1..238 37..274 853 61.8 Plus
Dyak\GE14105-PA 224 GE14105-PA 4..198 67..254 200 29.1 Plus
Dyak\GE25306-PA 324 GE25306-PA 46..225 68..247 196 29.8 Plus

FI08137.hyp Sequence

Translation from 53 to 1000

> FI08137.hyp
MALEAICGMNKMPFMRRFDDLQSEWQKEQLREATSNFENPYELMAPPFER
PAENLPKILSHCGIRMDFDHGTTTLGFKYRGGVILCADSRATSGQYIGSQ
TMRKIVELNDYMLGTLAGGAADCVYWDRVLAKECRLHQLRYRKRMTVDTA
ARIICNISTEYKGMGLVMGMMLAGFDDEGPKLIYVDSEGMRSHGQVFSVG
SGSPYALGVLDTGYRYDLSDQEAYDLARRAIYHATSKDAYSGGIVRLYHI
HSEGWRNICNTDCSDLHDSYCASGCPGNEKDVGNVGDPDNDKPCSSGWTK
KNITADNLQTKLATV*

FI08137.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Prosbeta5R1-PA 315 CG9868-PA 1..315 1..315 1699 100 Plus
Prosbeta5R2-PB 279 CG31742-PB 1..274 1..274 924 58.8 Plus
Prosbeta5R2-PA 279 CG31742-PA 1..274 1..274 924 58.8 Plus
Prosbeta5-PA 282 CG12323-PA 1..272 1..270 882 61.2 Plus
Prosbeta5-PB 282 CG12323-PB 1..272 1..270 882 61.2 Plus