Clone FI08143 Report

Search the DGRC for FI08143

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:81
Well:43
Vector:pOTB7
Associated Gene/TranscriptCG1288-RA
Protein status:FI08143.pep: gold
Sequenced Size:908

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1288 2008-08-15 Release 5.9 accounting
CG1288 2008-12-18 5.12 accounting

Clone Sequence Records

FI08143.complete Sequence

908 bp assembled on 2008-07-28

GenBank Submission: BT044393.1

> FI08143.complete
GCAGCACGCACCGTTTGGAATTCAAAATTTCCGTATAAAAACACAAAGTA
TACAAATTTAGTTTAAGATTTGGCACATTAAAATTTTTTGCTAATGGATA
TTTCCAAGGCCGAGAGTCAAACGCCCGCCGGAGATCGTCGATCTGCGAGT
CCTGATTATCTGAGAACTCTGCTGCAGGACATCCTGTGTTTCCTGGTCCT
GCTCTCGGTGGCCTTGCTAATTGTGGCTGGCATTTTGTTTGTGGTGGAGG
ACGTAAGCCGGCTCCAGCAGCAGCACCAACACCAGCCGTACCACCACCAC
CATCATCGCCACATGCGTCCGGATCAGATAGCCAATGAACTAAAAGGATC
GCCGATCGAGGAGGCACCGAGGGAGCAAGGTCAAGTCTTCCGACCGCACA
CATGGATTCGATTCTTTAACTGCAGGAACAAGGTGCCACAGCAACAGCAG
GAAAAAGTTGAAAGGGAGGCGGTTCAGTTTGGCCCACCAACGCAAGACGA
TCAGGCGCAGCAGATCCCATTAGATGCCGTTCAAACTTATCGCCCTGCCA
TAGAACCTATATCGCTGCGCTCTGGCGGAGATTACATAGATGAAACGATC
AACAAAAACCCGAATCCGGAACTTCGCCATTTTCTGCCCAATAATATTAT
GATCTAAAAGAATATGTCTAAAATGCTGTTTGAATGTCCAAATTGACCGC
TTGGCAGCTTCCAACTATCGGGTCTCTCCTGGTAGATTTGTCATTTGATG
TTTAGCATAGCATTTGCACCTTTTGAACAGTGGGCCATCAAGAGACTAGA
ACATTCCCCAACCTAATGTTTTCGCAGATAGCAAACATGCTGAATTGTGC
AATTAATAAAAGAATAGCTATGCTAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

FI08143.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG1288-RA 1085 CG1288-RA 92..967 1..876 4380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3033814..3034457 644..1 3205 99.8 Minus
chr3R 27901430 chr3R 3033529..3033762 874..641 1170 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7207760..7208403 644..1 3205 99.8 Minus
3R 32079331 3R 7207473..7207708 876..641 1180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6948591..6949234 644..1 3205 99.8 Minus
3R 31820162 3R 6948304..6948539 876..641 1180 100 Minus
Blast to na_te.dros performed 2019-03-16 15:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2307..2369 265..327 135 68.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6845..6888 265..311 129 78.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2457..2503 265..311 127 74.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2398 259..311 121 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6755..6817 265..327 117 65.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2349..2434 259..344 115 59.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2346..2395 265..313 112 72 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6734..6795 265..326 112 64.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6776..6822 265..311 109 70.2 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3288..3373 259..345 108 59.8 Plus

FI08143.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:34:12 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3033529..3033762 641..874 100 <- Minus
chr3R 3033818..3034457 1..640 92   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:15 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 1..564 94..657 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:17 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 1..564 94..657 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:48:18 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 1..564 94..657 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:13 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 1..564 94..657 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:49:01 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 1..564 94..657 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:35 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 13..886 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:17 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 13..886 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:48:18 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 13..886 1..874 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:14 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 13..886 1..874 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:49:01 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
CG1288-RA 29..902 1..874 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:12 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7207475..7207708 641..874 100 <- Minus
3R 7207764..7208403 1..640 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:12 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7207475..7207708 641..874 100 <- Minus
3R 7207764..7208403 1..640 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:12 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7207475..7207708 641..874 100 <- Minus
3R 7207764..7208403 1..640 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:48:18 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3033197..3033430 641..874 100 <- Minus
arm_3R 3033486..3034125 1..640 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:39 Download gff for FI08143.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6948306..6948539 641..874 100 <- Minus
3R 6948595..6949234 1..640 100   Minus

FI08143.hyp Sequence

Translation from 93 to 656

> FI08143.hyp
MDISKAESQTPAGDRRSASPDYLRTLLQDILCFLVLLSVALLIVAGILFV
VEDVSRLQQQHQHQPYHHHHHRHMRPDQIANELKGSPIEEAPREQGQVFR
PHTWIRFFNCRNKVPQQQQEKVEREAVQFGPPTQDDQAQQIPLDAVQTYR
PAIEPISLRSGGDYIDETINKNPNPELRHFLPNNIMI*

FI08143.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG1288-PB 187 CG1288-PB 1..187 1..187 991 100 Plus
CG1288-PA 187 CG1288-PA 1..187 1..187 991 100 Plus

FI08143.pep Sequence

Translation from 93 to 656

> FI08143.pep
MDISKAESQTPAGDRRSASPDYLRTLLQDILCFLVLLSVALLIVAGILFV
VEDVSRLQQQHQHQPYHHHHHRHMRPDQIANELKGSPIEEAPREQGQVFR
PHTWIRFFNCRNKVPQQQQEKVEREAVQFGPPTQDDQAQQIPLDAVQTYR
PAIEPISLRSGGDYIDETINKNPNPELRHFLPNNIMI*

FI08143.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17317-PA 189 GF17317-PA 1..164 1..166 338 46.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25326-PA 185 GG25326-PA 1..183 1..185 676 79.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG1288-PB 187 CG1288-PB 1..187 1..187 991 100 Plus
CG1288-PA 187 CG1288-PA 1..187 1..187 991 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12193-PA 167 GL12193-PA 1..101 1..117 171 33.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26221-PA 167 GA26221-PA 1..101 1..117 171 35.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10500-PA 188 GM10500-PA 1..188 1..187 766 88.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19496-PA 187 GD19496-PA 1..187 1..187 803 91.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11121-PA 179 GE11121-PA 1..177 1..185 655 81.1 Plus
Dyak\GE25807-PA 179 GE25807-PA 1..177 1..185 655 81.1 Plus