Clone FI08233 Report

Search the DGRC for FI08233

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:82
Well:33
Vector:pOTB7
Associated Gene/TranscriptCG10332-RA
Protein status:FI08233.pep: gold
Sequenced Size:756

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
IM18 2008-08-15 Release 5.9 accounting
CG10332 2008-08-15 Release 5.9 accounting
IM18 2008-12-18 5.12 accounting
CG10332 2008-12-18 5.12 accounting

Clone Sequence Records

FI08233.complete Sequence

756 bp assembled on 2008-07-29

GenBank Submission: BT044394.1

> FI08233.complete
TTTAGAGATAATCAAAATTAGCTGTTTTCATTTTCGTAAGCATGGACATT
AACCCAATAATCAGATCTATTCTCAGCCGCTTCAGAGGCTGCACCATCAG
AAGTTATCTGGTTGTTCTGCCCGATCAGAGTCGCATAGAAAATCAACTAA
AACTGGAGGATCTGCAAACAGAACGCGGAATCTTGGATCTGCAATCCCAT
GAGCTGGCACTCAAGCAAAAGCGCGTCGAGGCCAATCTAACCGACCTGAC
CCGCTGCATCCGTGGCATGGAGTTCGATGTGAAGGTGAATTCCAATCGCG
AGAGGAAGGAGAGAAAATCTGATCGACGCCCCCCAGCTGATAAGAAATCA
CCCAAAGTCGGTGATTTCAGCGAATAGCAAAATCCCCCCGGGTGCTTCCC
AATCCCAAGGGCATACGAGTGCAGCGTATAAAAACAAGCTATTGCCGGAG
GTCGGCATTCAGATTCACTTGAGATTGCCAACCATGAAGCTGATCGCATT
GTGCTGCCTGCTCCTTTTGGGCCTCCTGGGCTTCCTAGCTGCTCCCGGCG
TCGCCTCGCCATCTCGCCACACTGGACCAGGAAACGGATCGGGATCTGGA
GCTGGGTCCGGAAATCCGTTCAGGTCTCCAAGCTCACAGCAACGACCACT
GTACTACGACGCTCCGATTGGGAAACCATCGAAGACTATGTACGCCTGAC
GTAAAGAATGAAACAATAAAGATTTGAAACGCCTAAACTAAAAAAAAAAA
AAAAAA

FI08233.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
IM18-RA 739 IM18-RA 1..739 1..739 3680 99.8 Plus
CG10332-RA 739 CG10332-RA 1..739 1..739 3680 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:52:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 19487161..19487726 739..174 2815 99.8 Minus
chr2R 21145070 chr2R 19487921..19488020 100..1 485 99 Minus
chr2R 21145070 chr2R 19487797..19487869 171..99 350 98.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23600911..23601482 742..171 2860 100 Minus
2R 25286936 2R 23601674..23601773 100..1 500 100 Minus
2R 25286936 2R 23601550..23601622 171..99 350 98.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23602110..23602681 742..171 2860 100 Minus
2R 25260384 2R 23602873..23602972 100..1 500 100 Minus
2R 25260384 2R 23602749..23602821 171..99 350 98.6 Minus
Blast to na_te.dros performed on 2019-03-16 10:52:32 has no hits.

FI08233.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:53:35 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 19487161..19487729 171..739 99 <- Minus
chr2R 19487798..19487867 101..170 98 <- Minus
chr2R 19487921..19488020 1..100 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:20 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 1..336 42..377 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:34 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 1..336 42..377 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:04:36 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 1..336 42..377 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:56 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 1..336 42..377 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:10 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 1..336 42..377 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:36 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
IM18-RA 1..739 1..739 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:34 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 1..739 1..739 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:04:36 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
CG10332-RA 1..739 1..739 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:44:47 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
IM18-RA 1..739 1..739 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:10 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
IM18-RA 1..739 1..739 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:35 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23600914..23601482 171..739 100 <- Minus
2R 23601551..23601620 101..170 98 <- Minus
2R 23601674..23601773 1..100 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:35 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23600914..23601482 171..739 100 <- Minus
2R 23601551..23601620 101..170 98 <- Minus
2R 23601674..23601773 1..100 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:35 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23600914..23601482 171..739 100 <- Minus
2R 23601551..23601620 101..170 98 <- Minus
2R 23601674..23601773 1..100 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:04:36 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 19488437..19489005 171..739 100 <- Minus
arm_2R 19489074..19489143 101..170 98 <- Minus
arm_2R 19489197..19489296 1..100 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:38:08 Download gff for FI08233.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23602131..23602699 171..739 100 <- Minus
2R 23602768..23602837 101..170 98 <- Minus
2R 23602891..23602990 1..100 100   Minus

FI08233.pep Sequence

Translation from 41 to 376

> FI08233.pep
MDINPIIRSILSRFRGCTIRSYLVVLPDQSRIENQLKLEDLQTERGILDL
QSHELALKQKRVEANLTDLTRCIRGMEFDVKVNSNRERKERKSDRRPPAD
KKSPKVGDFSE*

FI08233.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11833-PA 191 GF11833-PA 1..122 3..109 293 51.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20013-PA 109 GG20013-PA 1..109 1..111 440 79.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-PA 111 CG10332-PA 1..111 1..111 561 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15525-PA 111 GM15525-PA 1..111 1..111 536 92.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25030-PA 111 GD25030-PA 1..111 1..111 527 91 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11550-PA 109 GE11550-PA 1..109 1..111 447 80.2 Plus

FI08233.hyp Sequence

Translation from 41 to 376

> FI08233.hyp
MDINPIIRSILSRFRGCTIRSYLVVLPDQSRIENQLKLEDLQTERGILDL
QSHELALKQKRVEANLTDLTRCIRGMEFDVKVNSNRERKERKSDRRPPAD
KKSPKVGDFSE*

FI08233.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:40:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG10332-PA 111 CG10332-PA 1..111 1..111 561 100 Plus