Clone FI08238 Report

Search the DGRC for FI08238

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:82
Well:38
Vector:pOTB7
Associated Gene/TranscriptCG14391-RA
Protein status:FI08238.pep: gold
Sequenced Size:633

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14391 2008-12-18 5.12 accounting

Clone Sequence Records

FI08238.complete Sequence

633 bp assembled on 2008-10-12

GenBank Submission: BT046143.1

> FI08238.complete
CTCACAACAGTACAATTTACACACAGCTTTAGTTAGGAGTTTAAAAAAGA
AATTTAAATATATTTCGTTGAAAGATTTATAAAAAAAAAAAGAACCATGG
AATTTGCCATACCAGAGGCTCAGTACTGGGACGTTTCGAAGAAATCCCAA
AAAGATCGTCAGATGATTCGTAAATTCGTGCCCGAGGCGGTCGACCTGGC
CACCATAAGTCGTGCAGAGATCTACAGGATTGACACATTCTATTTGGAGT
GCCAAAAGTACCGGGATCACTATCGTGACCCCTACGGCAAGGTCCACTGT
CCGGCATTCTTCCACCTGCACAAGGGCAAGTGCGGAATCAAGCTGGACCA
GAGCGTCATCAAGATGACGCAGGCGATTGCCGCAACTGTGGACCGGCAGC
CCATAGTTTTTCCCCTGATTCCGAACAAGAGCATGTTTTTGGGTGGTAGC
ATTCCCATGGGGTCACAAACATCCCAAGTTGGCGTCACTAGCTATCTCAG
ATGAAGAAAGTACAATTTTTTTGATAGCTAATGTATCCGCGGTAGTGTAA
AAAATCTTTCGAGCAATAAGATATTACTATCTGTTAGGTACATCCAAATA
TACAATAGCTTGTTGAAAAAAAAAAAAAAAAAA

FI08238.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG14391-RA 620 CG14391-RA 1..617 1..618 3000 99.5 Plus
Arp87C-RA 1543 Arp87C-RA 1474..1543 618..549 350 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8519470..8520084 615..1 3060 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12694226..12694842 618..1 2980 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12435057..12435673 618..1 3000 99.5 Minus
Blast to na_te.dros performed on 2019-03-16 07:32:14 has no hits.

FI08238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:33:07 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8519470..8520084 1..615 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:21 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..408 97..504 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:15 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..408 97..504 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:37:48 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..408 97..504 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:22 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..408 97..504 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:54:07 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..614 1..615 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:15 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..614 1..615 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:37:48 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..614 1..615 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-12 16:27:32 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..614 1..615 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:22 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
CG14391-RA 1..614 1..615 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:07 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12694229..12694842 1..615 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:07 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12694229..12694842 1..615 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:07 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12694229..12694842 1..615 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:37:48 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8519951..8520564 1..615 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:05 Download gff for FI08238.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12435060..12435673 1..615 99   Minus

FI08238.hyp Sequence

Translation from 96 to 503

> FI08238.hyp
MEFAIPEAQYWDVSKKSQKDRQMIRKFVPEAVDLATISRAEIYRIDTFYL
ECQKYRDHYRDPYGKVHCPAFFHLHKGKCGIKLDQSVIKMTQAIAATVDR
QPIVFPLIPNKSMFLGGSIPMGSQTSQVGVTSYLR*

FI08238.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG14391-PA 135 CG14391-PA 1..135 1..135 713 100 Plus
CG31347-PA 143 CG31347-PA 4..132 3..132 262 38.5 Plus
CG13110-PA 133 CG13110-PA 3..112 5..116 229 42 Plus
CG43796-PA 127 CG43796-PA 4..109 13..119 212 40.2 Plus

FI08238.pep Sequence

Translation from 96 to 503

> FI08238.pep
MEFAIPEAQYWDVSKKSQKDRQMIRKFVPEAVDLATISRAEIYRIDTFYL
ECQKYRDHYRDPYGKVHCPAFFHLHKGKCGIKLDQSVIKMTQAIAATVDR
QPIVFPLIPNKSMFLGGSIPMGSQTSQVGVTSYLR*

FI08238.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17872-PA 135 GF17872-PA 1..135 1..135 410 52.6 Plus
Dana\GF22722-PA 133 GF22722-PA 3..103 5..107 265 52.4 Plus
Dana\GF15522-PA 140 GF15522-PA 9..125 5..124 256 42.5 Plus
Dana\GF17873-PA 136 GF17873-PA 4..133 3..133 253 38.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17102-PA 135 GG17102-PA 1..135 1..135 708 97 Plus
Dere\GG17104-PA 143 GG17104-PA 4..132 3..132 264 38.5 Plus
Dere\GG25343-PA 134 GG25343-PA 3..112 5..116 225 40.2 Plus
Dere\GG25288-PA 1312 GG25288-PA 6..103 5..103 211 41.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13601-PA 137 GH13601-PA 6..121 5..123 251 44.5 Plus
Dgri\GH19560-PA 135 GH19560-PA 5..135 4..135 218 36.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14391-PA 135 CG14391-PA 1..135 1..135 713 100 Plus
CG31347-PA 143 CG31347-PA 4..132 3..132 262 38.5 Plus
CG13110-PA 133 CG13110-PA 3..112 5..116 229 42 Plus
CG43796-PA 127 CG43796-PA 4..109 13..119 212 40.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17431-PA 137 GI17431-PA 6..116 5..116 259 45.5 Plus
Dmoj\GI22263-PA 135 GI22263-PA 5..135 4..135 212 36.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26141-PA 133 GL26141-PA 3..103 5..107 229 44.7 Plus
Dper\GL26142-PA 133 GL26142-PA 3..103 5..107 202 39.8 Plus
Dper\GL23114-PA 123 GL23114-PA 2..123 11..135 183 35.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25300-PA 138 GA25300-PA 7..119 5..118 265 45.6 Plus
Dpse\GA25307-PA 133 GA25307-PA 3..103 5..107 229 44.7 Plus
Dpse\GA12052-PA 133 GA12052-PA 3..103 5..107 202 39.8 Plus
Dpse\GA28678-PA 133 GA28678-PA 3..103 5..107 202 39.8 Plus
Dpse\GA27147-PB 132 GA27147-PB 5..132 5..135 183 34.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25986-PA 135 GM25986-PA 1..135 1..135 708 97.8 Plus
Dsec\GM25988-PA 143 GM25988-PA 4..107 3..107 261 43.8 Plus
Dsec\GM17435-PA 133 GM17435-PA 3..112 5..116 216 39.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20547-PA 135 GD20547-PA 1..135 1..135 699 96.3 Plus
Dsim\GD20548-PA 143 GD20548-PA 4..132 3..132 264 38.5 Plus
Dsim\GD23598-PA 133 GD23598-PA 3..112 5..116 224 40.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18378-PA 137 GJ18378-PA 6..137 5..135 235 39.1 Plus
Dvir\GJ24054-PA 135 GJ24054-PA 5..135 4..135 208 35.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18959-PA 128 GK18959-PA 2..128 4..135 237 36.8 Plus
Dwil\GK24173-PA 1339 GK24173-PA 4..84 13..94 212 48.8 Plus
Dwil\GK24199-PA 134 GK24199-PA 3..98 5..103 159 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:17:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24492-PA 135 GE24492-PA 1..135 1..135 708 97 Plus
Dyak\GE24493-PA 143 GE24493-PA 4..132 3..132 267 40 Plus
Dyak\GE18778-PA 137 GE18778-PA 6..121 5..123 247 42.9 Plus
Dyak\GE18835-PA 133 GE18835-PA 3..112 5..116 225 40.2 Plus