Clone FI08267 Report

Search the DGRC for FI08267

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:82
Well:67
Vector:pOTB7
Associated Gene/TranscriptCG32713-RA
Protein status:FI08267.pep: gold
Sequenced Size:722

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32713 2008-08-15 Release 5.9 accounting
CG32713 2008-12-18 5.12 accounting

Clone Sequence Records

FI08267.complete Sequence

722 bp assembled on 2008-07-28

GenBank Submission: BT044398.1

> FI08267.complete
CTTGTGTATAAAATCTAAAATTATCTATATATATATATATATATATATAT
ATATAAATTCGGGCATCAGGATGCGGAAGGTCCAAGTTTTGGTTCAGACG
CGCGACGGCAAGAAGACCGTCTACGAGGTGGATCGCTTAGGAACGGTGGC
CAGCCTGAAGGCACGGATCGGGCAGGTCATGTCCGTGCCCATGGGCTTCA
GTCGGCTGTCGTACAAGGGTCGCGTGCTATCCAATCAGAGCGTACTGGAG
GATTTGGGGCCCAATAAGTCCACCCTGGATCTCACCTGGAAGCCGGTCGT
CCTGACGGCCAATCAGAGCAGCAAGTTAAGCAAGTTCGGCTATGGCAGGA
TAGACGATAGTGAAGTTATGTTTACACTGATCGGTGGCTATCAGCAACGC
GAAGAATATCCTGGTGGCCTAGTCAATCCACCGGACGACGAAAGTCAACT
AAACTTCAACGCAGGTGACGATGATGATGCACTGGAGGCCCAGGACATGA
CTGGACACGATTTGTCCTCAATTCAAACCGATGATTTATCGCTCAAAGGC
CAGACGGAACCGGAGCTGGATTGCTCCATTGGATCTCATGGATTCTCTGG
ATCTCAAGAAGAAGGCCACGAATAACGACAATGAGAAGTAGACTGTTGTA
AATTATCTTAAATTAAAAATATTTAGTCGTCATTTAATTTCGAAATTCCT
TTAAAAAAAAAAAAAAAAAAAA

FI08267.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG33223-RA 1046 CG33223-RA 426..1046 1..625 2890 97.7 Plus
CG32713-RA 555 CG32713-RA 1..555 71..625 2760 99.8 Plus
CG12725-RA 1025 CG12725-RA 116..388 37..312 845 87.6 Plus
CG12725-RA 1025 CG12725-RA 624..699 593..668 200 84.2 Plus
CG12725-RA 1025 CG12725-RA 412..453 321..362 165 92.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 11:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 8348706..8349409 702..1 3440 99.6 Minus
chrX 22417052 chrX 8357476..8358156 685..1 3075 96.9 Minus
chrX 22417052 chrX 13293272..13293544 312..37 805 87 Minus
chrX 22417052 chrX 13292961..13293147 668..473 235 77 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 8456927..8457632 704..1 3450 99.6 Minus
X 23542271 X 8465698..8466378 685..1 3090 97.1 Minus
X 23542271 X 13402476..13402748 312..37 835 87.7 Minus
X 23542271 X 13402165..13402351 668..473 235 77 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:21
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 8465025..8465730 704..1 3460 99.5 Minus
X 23527363 X 8473796..8474476 685..1 3100 97 Minus
X 23527363 X 13410574..13410846 312..37 845 87.6 Minus
X 23527363 X 13410263..13410338 668..593 200 84.2 Minus
X 23527363 X 13410509..13410550 362..321 165 92.8 Minus
Blast to na_te.dros performed 2019-03-15 11:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy11 4428 gypsy11 GYPSY11 4428bp 1628..1697 8..78 109 63.4 Plus

FI08267.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 11:47:59 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 8348706..8349409 1..702 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:27 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..555 71..625 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:57 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..555 71..625 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:33:03 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..555 71..625 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:07 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..555 71..625 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:42:31 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..555 71..625 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:08 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 426..1046 1..625 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:57 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..704 1..702 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:33:03 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..704 1..702 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:32 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG33223-RA 426..1046 1..625 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:42:31 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
CG32713-RA 1..704 1..702 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:59 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
X 8456929..8457632 1..702 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:59 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
X 8456929..8457632 1..702 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 11:47:59 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
X 8456929..8457632 1..702 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:33:03 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 8350962..8351665 1..702 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:11 Download gff for FI08267.complete
Subject Subject Range Query Range Percent Splice Strand
X 8465027..8465730 1..702 99   Minus

FI08267.pep Sequence

Translation from 1 to 624

> FI08267.pep
LCIKSKIIYIYIYIYIYINSGIRMRKVQVLVQTRDGKKTVYEVDRLGTVA
SLKARIGQVMSVPMGFSRLSYKGRVLSNQSVLEDLGPNKSTLDLTWKPVV
LTANQSSKLSKFGYGRIDDSEVMFTLIGGYQQREEYPGGLVNPPDDESQL
NFNAGDDDDALEAQDMTGHDLSSIQTDDLSLKGQTEPELDCSIGSHGFSG
SQEEGHE*

FI08267.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22365-PA 267 GF22365-PA 1..83 24..105 297 67.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19048-PA 205 GG19048-PA 1..137 24..154 411 62.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12233-PA 234 GH12233-PA 1..86 24..108 261 58.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG32713-PB 184 CG32713-PB 1..184 24..207 947 100 Plus
CG32713-PA 184 CG32713-PA 1..184 24..207 947 100 Plus
CG33223-PB 184 CG33223-PB 1..184 24..207 923 97.3 Plus
CG33223-PA 184 CG33223-PA 1..184 24..207 923 97.3 Plus
CG12725-PA 163 CG12725-PA 1..162 24..201 461 60.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15768-PA 343 GI15768-PA 1..83 24..105 259 59 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20310-PA 226 GL20310-PA 1..84 27..109 202 46.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28796-PA 226 GA28796-PA 1..84 27..109 202 46.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21312-PA 189 GM21312-PA 1..165 24..190 627 75.4 Plus
Dsec\GM21345-PA 188 GM21345-PA 1..164 24..188 623 73.9 Plus
Dsec\GM12963-PA 162 GM12963-PA 1..162 24..202 491 62.6 Plus
Dsec\GM22658-PA 162 GM22658-PA 1..162 24..202 490 62 Plus
Dsec\GM11493-PA 171 GM11493-PA 1..146 24..186 428 58.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16114-PA 183 GD16114-PA 1..159 24..190 570 69.5 Plus
Dsim\GD16110-PA 181 GD16110-PA 1..157 24..190 535 70.1 Plus
Dsim\GD15887-PA 136 GD15887-PA 1..110 60..186 280 51.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18624-PA 313 GJ18624-PA 1..129 24..145 263 45.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19892-PA 254 GK19892-PA 1..80 27..105 241 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17453-PA 238 GE17453-PA 1..185 24..186 383 55.1 Plus

FI08267.hyp Sequence

Translation from 70 to 624

> FI08267.hyp
MRKVQVLVQTRDGKKTVYEVDRLGTVASLKARIGQVMSVPMGFSRLSYKG
RVLSNQSVLEDLGPNKSTLDLTWKPVVLTANQSSKLSKFGYGRIDDSEVM
FTLIGGYQQREEYPGGLVNPPDDESQLNFNAGDDDDALEAQDMTGHDLSS
IQTDDLSLKGQTEPELDCSIGSHGFSGSQEEGHE*

FI08267.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:41:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG32713-PB 184 CG32713-PB 1..184 1..184 947 100 Plus
CG32713-PA 184 CG32713-PA 1..184 1..184 947 100 Plus
CG33223-PB 184 CG33223-PB 1..184 1..184 923 97.3 Plus
CG33223-PA 184 CG33223-PA 1..184 1..184 923 97.3 Plus
CG12725-PA 163 CG12725-PA 1..162 1..178 461 60.3 Plus