Clone FI08349 Report

Search the DGRC for FI08349

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:83
Well:49
Vector:pOTB7
Associated Gene/TranscriptCG10063-RA
Protein status:FI08349.pep: gold
Sequenced Size:798

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10063 2008-08-15 Release 5.9 accounting
CG10063 2008-12-18 5.12 accounting

Clone Sequence Records

FI08349.complete Sequence

798 bp assembled on 2008-07-28

GenBank Submission: BT032670

> FI08349.complete
TGTTGAAATTGTCAATTGCTTCAGTGAAGAATTTTTAATCTGCTTAAACT
TGGAAAATAATGATTCGCGCCATGGTAATGACCAAATGGAGTAAGTCGGT
GGCGGGACCACTGGTCACGGCGTGGAACTACTCCACATTGAATCGGCTCA
ATGGCAATACTGTGCGCCCGCGTGCTCTGTTCCTGAATCTCGACCGCAAG
TTCTCCGCCGAAGGTGGCGGCGATGAGAAGCCCAAGAATGTGCCTCCCGG
CTTTGCGGCTCCAGGGTTTCCATCCACCTTGGGCAATAACCCAGAGAACA
CTACGCGTAAGGATGTGCCCATTGGCGAGGTGCAGGCGCCAACTATTTCC
GTAGTGAACGCAGGTGGTAAACTGGGCAGAGCCGAGCCACTGGAGGCCAG
CACCATCGTGCGCAGCAAGGGCACTTCGAACGAGGACAAGATGACCGAGG
CGCAGAAGAAGGCATCGGAGGCCAAGGAGGCGGCCGCCAAGCAGTTGCAG
GATGTCATGGCCAACTTGCCCAGCAAGGAGCAGACCGAAAAGTATTTCTT
TCGCGTGGTTGCCTTCTTCTATGACTTGACCTACCTAACCGCCACCTGGT
TGCTCAACTTTGTCGAGCACAATATCGTTCAAAATGCCAAGGTGCAGCAC
TACTGGAAGCGATTCCACGAAAAAATGGAGCAGGCCAAGAAGGATTAACT
CCCAGCGGAGCCGAAAAATATATTATAAAACTCATGCGAAAGCAAAAAAT
AAAACAACTCGCTGACGAGTACAAAATTACAAAAAAAAAAAAAAAAAA

FI08349.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG10063-RA 867 CG10063-RA 90..867 1..781 3685 98.3 Plus
CG9953-RA 1949 CG9953-RA 1855..1949 781..687 475 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:44:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6963854..6964507 780..127 3195 99.2 Minus
chr3L 24539361 chr3L 6964572..6964697 126..1 630 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:44:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6971575..6972229 781..127 3140 98.6 Minus
3L 28110227 3L 6972292..6972414 126..1 535 96.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:20:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6964675..6965329 781..127 3140 98.6 Minus
3L 28103327 3L 6965392..6965514 126..1 545 96.8 Minus
Blast to na_te.dros performed on 2019-03-16 16:44:44 has no hits.

FI08349.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:45:28 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6963854..6964507 127..780 99 <- Minus
chr3L 6964572..6964697 1..126 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:32 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 1..639 60..698 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:03:10 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 1..639 60..698 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:43:47 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 1..639 60..698 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 14:45:31 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 1..639 60..698 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:40:01 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 1..639 60..698 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:22:39 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 8..784 1..780 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:03:10 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 8..784 1..780 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:43:47 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 54..827 1..777 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:20:54 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 8..784 1..780 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:40:01 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
CG10063-RA 54..827 1..777 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:28 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6971576..6972229 127..780 98 <- Minus
3L 6972292..6972414 1..126 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:28 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6971576..6972229 127..780 98 <- Minus
3L 6972292..6972414 1..126 96   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:45:28 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6971576..6972229 127..780 98 <- Minus
3L 6972292..6972414 1..126 96   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:47 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6964676..6965329 127..780 98 <- Minus
arm_3L 6965392..6965514 1..126 96   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:31:09 Download gff for FI08349.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6964676..6965329 127..780 98 <- Minus
3L 6965392..6965514 1..126 96   Minus

FI08349.hyp Sequence

Translation from 59 to 697

> FI08349.hyp
MIRAMVMTKWSKSVAGPLVTAWNYSTLNRLNGNTVRPRALFLNLDRKFSA
EGGGDEKPKNVPPGFAAPGFPSTLGNNPENTTRKDVPIGEVQAPTISVVN
AGGKLGRAEPLEASTIVRSKGTSNEDKMTEAQKKASEAKEAAAKQLQDVM
ANLPSKEQTEKYFFRVVAFFYDLTYLTATWLLNFVEHNIVQNAKVQHYWK
RFHEKMEQAKKD*

FI08349.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10063-PA 212 CG10063-PA 1..212 1..212 1103 100 Plus

FI08349.pep Sequence

Translation from 59 to 697

> FI08349.pep
MIRAMVMTKWSKSVAGPLVTAWNYSTLNRLNGNTVRPRALFLNLDRKFSA
EGGGDEKPKNVPPGFAAPGFPSTLGNNPENTTRKDVPIGEVQAPTISVVN
AGGKLGRAEPLEASTIVRSKGTSNEDKMTEAQKKASEAKEAAAKQLQDVM
ANLPSKEQTEKYFFRVVAFFYDLTYLTATWLLNFVEHNIVQNAKVQHYWK
RFHEKMEQAKKD*

FI08349.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10880-PA 228 GF10880-PA 29..228 46..212 369 48.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15012-PA 220 GG15012-PA 1..220 1..212 875 82.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16100-PA 206 GH16100-PA 121..206 123..212 271 55.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG10063-PA 212 CG10063-PA 1..212 1..212 1103 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12365-PA 247 GI12365-PA 30..247 9..212 280 34.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15061-PA 266 GL15061-PA 1..266 1..212 268 31.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10042-PA 266 GA10042-PA 1..266 1..212 266 31.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13801-PA 212 GM13801-PA 1..212 1..212 1007 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13100-PA 212 GD13100-PA 1..212 1..212 1016 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12257-PA 241 GJ12257-PA 171..241 142..212 295 73.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17196-PA 277 GK17196-PA 148..277 103..212 308 48.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20455-PA 213 GE20455-PA 1..213 1..212 881 82.3 Plus