BDGP Sequence Production Resources |
Search the DGRC for FI08403
Library: | FI |
Tissue Source: | various Drosophila melanogaster |
Created by: | |
Date Registered: | 2005-11-08 |
Comments: | Drosophila melanogaster corrected cDNA clones |
Original Plate Number: | 84 |
Well: | 3 |
Vector: | pOTB7 |
Associated Gene/Transcript | CG12439-RA |
Protein status: | FI08403.pep: gold |
Sequenced Size: | 841 |
Gene | Date | Evidence |
---|---|---|
CG12439 | 2008-12-18 | 5.12 accounting |
841 bp assembled on 2008-09-15
GenBank Submission: BT044518.1
> FI08403.complete GTAGAATACACCCAATGTATTTATACGTTAAAAAAACAAAGATAAACCGA AGATGGTCAGCGCAAAAACTATTATAGCTACTGGTGTGCTGAACATCCTG GGCATTTCCTTTTTCGTGGCCCAGCCAAAGGATCGATGCTCGGCAGCTCC ACCCGTTGGAAAGTATATCTTCCTACTAGCTATTCTTCTGCTCTTTTGGG ATTCAGACATGATTCCAAGGAAATTGAAACCGTTTTCCCCACGGATTTTT GCCTGCGGAGATCTTTTATTCACGATCTTCTTCACCGAAATAATCCTGCT GGTCGGATGGTGTGGCCTCGAGAGGATGACCTATCGATTTATATTTTCTG TGTGCCGTGGAAAACCTGGTTGCAATTACGGATTAATGACTTTCTGCAGC ATCTTAGGTGCCGTTGGATCACTATGCATTGTGCTCGAGGTGTTGACACA GCGGAAGATGAAGAATTTGGTGGGACAGAACAGTGCCGGCTTGCTTATTC CTCAGGACGCCGGACCAGTGTTCAAATTCATTCATGATGTGCGAACCTTT GTGAGGGGCGCCATATACTTTTTCCAATTGACTCGGGAGGAACGTATTCT ATCAGTCCACGCCTTCGAGGCTCAATTGCGCTACAAGAAGGGACAGGACG TACAACCTGGTGAACCTGCTGTCCAGGATTCCGGGAATCAAATGGACGCC GGTAAATCGACGACAGAACCGGAAATCGTCCACGAGTTGTCCCCGTAAAT TGTTTATTATTTATACAAATTTATGCCAACAGCTGTTGCTACCGCCGTCA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12439-RA | 799 | CG12439-RA | 1..799 | 1..799 | 3905 | 99.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 9076100..9076871 | 28..799 | 3710 | 98.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 9077217..9077988 | 28..799 | 3785 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 9077217..9077988 | 28..799 | 3785 | 99.3 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 9076004..9076035 | 1..32 | 96 | -> | Plus |
chr2L | 9076105..9076871 | 33..799 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..696 | 53..748 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..696 | 53..748 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..696 | 53..748 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..696 | 53..748 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..799 | 1..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..799 | 1..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..799 | 1..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..799 | 1..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12439-RA | 1..799 | 1..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9077121..9077152 | 1..32 | 93 | -> | Plus |
2L | 9077222..9077988 | 33..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9077121..9077152 | 1..32 | 93 | -> | Plus |
2L | 9077222..9077988 | 33..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9077121..9077152 | 1..32 | 93 | -> | Plus |
2L | 9077222..9077988 | 33..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 9077121..9077152 | 1..32 | 93 | -> | Plus |
arm_2L | 9077222..9077988 | 33..799 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 9077222..9077988 | 33..799 | 99 | Plus | |
2L | 9077121..9077152 | 1..32 | 93 | -> | Plus |
Translation from 52 to 747
> FI08403.pep MVSAKTIIATGVLNILGISFFVAQPKDRCSAAPPVGKYIFLLAILLLFWD SDMIPRKLKPFSPRIFACGDLLFTIFFTEIILLVGWCGLERMTYRFIFSV CRGKPGCNYGLMTFCSILGAVGSLCIVLEVLTQRKMKNLVGQNSAGLLIP QDAGPVFKFIHDVRTFVRGAIYFFQLTREERILSVHAFEAQLRYKKGQDV QPGEPAVQDSGNQMDAGKSTTEPEIVHELSP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22703-PA | 234 | GF22703-PA | 1..217 | 1..217 | 496 | 46.5 | Plus |
Dana\GF22725-PA | 211 | GF22725-PA | 6..93 | 7..94 | 153 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25344-PA | 203 | GG25344-PA | 10..199 | 11..199 | 180 | 28.5 | Plus |
Dere\GG25329-PA | 64 | GG25329-PA | 1..30 | 1..30 | 140 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13262-PA | 204 | GH13262-PA | 1..204 | 1..202 | 217 | 28.3 | Plus |
Dgri\GH13323-PA | 209 | GH13323-PA | 6..91 | 7..92 | 187 | 40.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12439-PB | 231 | CG12439-PB | 1..231 | 1..231 | 1202 | 100 | Plus |
CG12439-PA | 231 | CG12439-PA | 1..231 | 1..231 | 1202 | 100 | Plus |
CG34181-PA | 203 | CG34181-PA | 3..95 | 7..100 | 152 | 35.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17460-PA | 202 | GI17460-PA | 1..200 | 1..202 | 222 | 30.9 | Plus |
Dmoj\GI17662-PA | 256 | GI17662-PA | 1..116 | 2..115 | 193 | 32.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26243-PA | 282 | GL26243-PA | 1..208 | 1..204 | 306 | 35.1 | Plus |
Dper\GL26143-PA | 312 | GL26143-PA | 109..198 | 3..94 | 165 | 38 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11635-PA | 278 | GA11635-PA | 1..208 | 1..204 | 306 | 35.1 | Plus |
Dpse\GA25308-PA | 265 | GA25308-PA | 62..151 | 3..94 | 164 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17381-PA | 231 | GM17381-PA | 1..231 | 1..231 | 1061 | 92.2 | Plus |
Dsec\GM17437-PA | 203 | GM17437-PA | 3..134 | 7..129 | 176 | 36.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23584-PA | 201 | GD23584-PA | 1..201 | 1..231 | 847 | 80.1 | Plus |
Dsim\GD23599-PA | 203 | GD23599-PA | 19..134 | 20..129 | 164 | 37 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14401-PA | 199 | GJ14401-PA | 1..187 | 1..191 | 263 | 31.9 | Plus |
Dvir\GJ17858-PA | 213 | GJ17858-PA | 5..93 | 6..94 | 168 | 34.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24200-PA | 217 | GK24200-PA | 1..124 | 1..123 | 158 | 31.2 | Plus |
Translation from 52 to 747
> FI08403.hyp MVSAKTIIATGVLNILGISFFVAQPKDRCSAAPPVGKYIFLLAILLLFWD SDMIPRKLKPFSPRIFACGDLLFTIFFTEIILLVGWCGLERMTYRFIFSV CRGKPGCNYGLMTFCSILGAVGSLCIVLEVLTQRKMKNLVGQNSAGLLIP QDAGPVFKFIHDVRTFVRGAIYFFQLTREERILSVHAFEAQLRYKKGQDV QPGEPAVQDSGNQMDAGKSTTEPEIVHELSP*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12439-PB | 231 | CG12439-PB | 1..231 | 1..231 | 1202 | 100 | Plus |
CG12439-PA | 231 | CG12439-PA | 1..231 | 1..231 | 1202 | 100 | Plus |
CG34181-PA | 203 | CG34181-PA | 3..95 | 7..100 | 152 | 35.1 | Plus |