FI08413.complete Sequence
565 bp assembled on 2008-07-28
GenBank Submission: BT044399.1
> FI08413.complete
TAAAAAAATTCTCAAGTAATTTATACGCGTGTCATTTGTAGGGGAATTCC
TTTGGTTACTTGCCATGTACCATTCTTCAGGCCCATGTCGTGCCCACTTC
AGGCGATCCAGTCAGCGTGATCGGTTGCCCAGGCTGAGTAGCTCGTCCAC
CATGGATGTGGCACCTCGCTTTCAGAGAATACGACGCGGGAGCACTTGCG
AGGCGGAGAGGCGAGTGGCCAAGGCGGCCCAGGACGCCAATGTGCCGCCG
GCCAAGCTCTATCTACGCTCCACCTCACGGGGATTGCGTCGTGTCCTCGA
GATCTATATGCCACGATTCCAGCCCGACGAGCACTTGGCCAGCGCCGAGG
AGGAGCAGCGGTCAGAGGACGAACTTGGCGAGTCAGCCAGGACACGGGAG
CCACAGGAAGCTCTGCCCATTGCCACCAACTGGGCGGTGGTGAAGTGGCG
GACGTCGGATGCGGTCGCCTGATGGCATCTTGCTTGGATTTGCTTAACGA
CCACTTGATGGGGCTCCTCCTGCACTTGGGAGTGGAGGATGATTGAAAAA
AAAAAAAAAAAAAAA
FI08413.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:02:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13989.a | 892 | CG13989.a | 82..632 | 1..551 | 2755 | 100 | Plus |
CG13989-RA | 641 | CG13989-RA | 82..632 | 1..551 | 2755 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:07:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 6159519..6160012 | 1..494 | 2470 | 100 | Plus |
chr2L | 23010047 | chr2L | 6160068..6160118 | 495..545 | 255 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:07:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6160468..6160961 | 1..494 | 2470 | 100 | Plus |
2L | 23513712 | 2L | 6161017..6161073 | 495..551 | 285 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 6160468..6160961 | 1..494 | 2470 | 100 | Plus |
2L | 23513712 | 2L | 6161017..6161073 | 495..551 | 285 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 22:07:51 has no hits.
FI08413.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:08:47 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 6159519..6160012 | 1..494 | 100 | -> | Plus |
chr2L | 6160068..6160118 | 495..545 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:37 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 1..408 | 65..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:02 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 1..408 | 65..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:09:07 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 1..408 | 65..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:09 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 1..408 | 65..472 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:19 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 1..408 | 65..472 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:16 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 25..569 | 1..545 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:02 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 25..569 | 1..545 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:09:07 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 69..613 | 1..545 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:31 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 25..569 | 1..545 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:19 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13989-RA | 69..613 | 1..545 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:47 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6160468..6160961 | 1..494 | 100 | -> | Plus |
2L | 6161017..6161067 | 495..545 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:47 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6160468..6160961 | 1..494 | 100 | -> | Plus |
2L | 6161017..6161067 | 495..545 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:47 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6160468..6160961 | 1..494 | 100 | -> | Plus |
2L | 6161017..6161067 | 495..545 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:09:07 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 6160468..6160961 | 1..494 | 100 | -> | Plus |
arm_2L | 6161017..6161067 | 495..545 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:18 Download gff for
FI08413.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 6160468..6160961 | 1..494 | 100 | -> | Plus |
2L | 6161017..6161067 | 495..545 | 100 | | Plus |
FI08413.hyp Sequence
Translation from 64 to 471
> FI08413.hyp
MYHSSGPCRAHFRRSSQRDRLPRLSSSSTMDVAPRFQRIRRGSTCEAERR
VAKAAQDANVPPAKLYLRSTSRGLRRVLEIYMPRFQPDEHLASAEEEQRS
EDELGESARTREPQEALPIATNWAVVKWRTSDAVA*
FI08413.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13989-PA | 135 | CG13989-PA | 1..135 | 1..135 | 693 | 100 | Plus |
FI08413.pep Sequence
Translation from 64 to 471
> FI08413.pep
MYHSSGPCRAHFRRSSQRDRLPRLSSSSTMDVAPRFQRIRRGSTCEAERR
VAKAAQDANVPPAKLYLRSTSRGLRRVLEIYMPRFQPDEHLASAEEEQRS
EDELGESARTREPQEALPIATNWAVVKWRTSDAVA*
FI08413.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14509-PA | 184 | GF14509-PA | 1..116 | 1..104 | 193 | 48.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG10396-PA | 182 | GG10396-PA | 2..109 | 3..105 | 296 | 65.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13989-PA | 135 | CG13989-PA | 1..135 | 1..135 | 693 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM18611-PA | 129 | GM18611-PA | 1..129 | 1..135 | 514 | 83.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23393-PA | 129 | GD23393-PA | 1..129 | 1..135 | 516 | 84.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE13714-PA | 125 | GE13714-PA | 1..104 | 1..107 | 325 | 72.9 | Plus |