Clone FI08413 Report

Search the DGRC for FI08413

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:84
Well:13
Vector:pOTB7
Associated Gene/TranscriptCG13989-RA
Protein status:FI08413.pep: gold
Sequenced Size:565

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13989 2008-08-15 Release 5.9 accounting
CG13989 2008-12-18 5.12 accounting

Clone Sequence Records

FI08413.complete Sequence

565 bp assembled on 2008-07-28

GenBank Submission: BT044399.1

> FI08413.complete
TAAAAAAATTCTCAAGTAATTTATACGCGTGTCATTTGTAGGGGAATTCC
TTTGGTTACTTGCCATGTACCATTCTTCAGGCCCATGTCGTGCCCACTTC
AGGCGATCCAGTCAGCGTGATCGGTTGCCCAGGCTGAGTAGCTCGTCCAC
CATGGATGTGGCACCTCGCTTTCAGAGAATACGACGCGGGAGCACTTGCG
AGGCGGAGAGGCGAGTGGCCAAGGCGGCCCAGGACGCCAATGTGCCGCCG
GCCAAGCTCTATCTACGCTCCACCTCACGGGGATTGCGTCGTGTCCTCGA
GATCTATATGCCACGATTCCAGCCCGACGAGCACTTGGCCAGCGCCGAGG
AGGAGCAGCGGTCAGAGGACGAACTTGGCGAGTCAGCCAGGACACGGGAG
CCACAGGAAGCTCTGCCCATTGCCACCAACTGGGCGGTGGTGAAGTGGCG
GACGTCGGATGCGGTCGCCTGATGGCATCTTGCTTGGATTTGCTTAACGA
CCACTTGATGGGGCTCCTCCTGCACTTGGGAGTGGAGGATGATTGAAAAA
AAAAAAAAAAAAAAA

FI08413.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:02:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13989.a 892 CG13989.a 82..632 1..551 2755 100 Plus
CG13989-RA 641 CG13989-RA 82..632 1..551 2755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:07:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6159519..6160012 1..494 2470 100 Plus
chr2L 23010047 chr2L 6160068..6160118 495..545 255 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:07:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6160468..6160961 1..494 2470 100 Plus
2L 23513712 2L 6161017..6161073 495..551 285 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6160468..6160961 1..494 2470 100 Plus
2L 23513712 2L 6161017..6161073 495..551 285 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:07:51 has no hits.

FI08413.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:08:47 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6159519..6160012 1..494 100 -> Plus
chr2L 6160068..6160118 495..545 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:37 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 1..408 65..472 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:02 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 1..408 65..472 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:09:07 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 1..408 65..472 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:09 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 1..408 65..472 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:19 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 1..408 65..472 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:16 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 25..569 1..545 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:02 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 25..569 1..545 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:09:07 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 69..613 1..545 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:31 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 25..569 1..545 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:19 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
CG13989-RA 69..613 1..545 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:47 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6160468..6160961 1..494 100 -> Plus
2L 6161017..6161067 495..545 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:47 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6160468..6160961 1..494 100 -> Plus
2L 6161017..6161067 495..545 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:08:47 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6160468..6160961 1..494 100 -> Plus
2L 6161017..6161067 495..545 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:09:07 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6160468..6160961 1..494 100 -> Plus
arm_2L 6161017..6161067 495..545 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:18 Download gff for FI08413.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6160468..6160961 1..494 100 -> Plus
2L 6161017..6161067 495..545 100   Plus

FI08413.hyp Sequence

Translation from 64 to 471

> FI08413.hyp
MYHSSGPCRAHFRRSSQRDRLPRLSSSSTMDVAPRFQRIRRGSTCEAERR
VAKAAQDANVPPAKLYLRSTSRGLRRVLEIYMPRFQPDEHLASAEEEQRS
EDELGESARTREPQEALPIATNWAVVKWRTSDAVA*

FI08413.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13989-PA 135 CG13989-PA 1..135 1..135 693 100 Plus

FI08413.pep Sequence

Translation from 64 to 471

> FI08413.pep
MYHSSGPCRAHFRRSSQRDRLPRLSSSSTMDVAPRFQRIRRGSTCEAERR
VAKAAQDANVPPAKLYLRSTSRGLRRVLEIYMPRFQPDEHLASAEEEQRS
EDELGESARTREPQEALPIATNWAVVKWRTSDAVA*

FI08413.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14509-PA 184 GF14509-PA 1..116 1..104 193 48.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10396-PA 182 GG10396-PA 2..109 3..105 296 65.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13989-PA 135 CG13989-PA 1..135 1..135 693 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18611-PA 129 GM18611-PA 1..129 1..135 514 83.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23393-PA 129 GD23393-PA 1..129 1..135 516 84.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13714-PA 125 GE13714-PA 1..104 1..107 325 72.9 Plus