Clone FI08415 Report

Search the DGRC for FI08415

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:84
Well:15
Vector:pOTB7
Associated Gene/TranscriptCG6527-RA
Protein status:FI08415.pep: gold
Sequenced Size:785

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6527 2008-08-15 Release 5.9 accounting
CG6527 2008-12-18 5.12 accounting

Clone Sequence Records

FI08415.complete Sequence

785 bp assembled on 2008-07-28

GenBank Submission: BT044401.1

> FI08415.complete
ATCCAAATTTTAAGTAAATGTAAAAAGTACTTTACAAATAGTTTTTCAAA
TTCGTTTTTAACCAATATGTCTGCAAATTCCAATTCACTAGAAATTTCAC
CGAATAGTACTTTAACTTTCACAAAAACCAACAATAAGCATGAAATAACC
ATCAAAAATGTTGGCGAAAAGACAGTGACCTACAAGGTGCAATGTACAGT
GCATGGCAAGTTCAATATAAAACCCCGCTGGGGAGTCCTCAGTCCCAATG
AGCACTCACATGTCCTCATAACCATGTGCAAGGATGTCGAGCTCTCGAGA
AAGGGACGCGACAAGATAGTGGTCGTTTGCATGGTTTCACCCATCAATGC
TGTGGACTTCGAGATGACCGCCTCCTTCTGGCGTCACAATATCTGCTACG
ATCCAAGTATCGAGAAGCACCAACTCACCTGCCATCAAATGGATGGGGCG
GGCGAGGGCCATGGCGACGGAGGCGACAAGGATGCGGAGCCGGAGGATCT
AAGGTTTCGCCAGGGGTTATTCCCATCATTTTGCAGTATTCGCACTCCGA
GCAAGTACTGGCGATAGTTTTCGACCGGAGATGGGATGCGGCATTTTCAC
CCATCAGACCATCAGACTGGAGTGTCAATTATCCCGCCCGAGCATTTTGC
CCTAATGGCTTCAATGACTGAGTAATTGGTTAGCAGCCCTACCTTGTCTT
TCTGTGCGCCTCTATCGGCCAACATTGTTGATGATGAGCCTTCATTAAAA
ACTAAGAGCGTGTCTAAAAAAAAAAAAAAAAAAAA

FI08415.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG6527.a 1998 CG6527.a 92..857 1..766 3725 99 Plus
CG6527-RA 856 CG6527-RA 92..856 1..765 3720 99 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:13:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10549555..10550135 765..185 2875 99.7 Minus
chr3L 24539361 chr3L 10550194..10550381 188..1 895 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10558164..10558745 766..185 2850 99.3 Minus
3L 28110227 3L 10558804..10558991 188..1 895 98.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10551264..10551845 766..185 2850 99.3 Minus
3L 28103327 3L 10551904..10552091 188..1 895 98.4 Minus
Blast to na_te.dros performed 2019-03-15 23:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
Circe 7450 Circe CIRC 7450bp 6537..6622 25..118 118 65.3 Plus

FI08415.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:13:54 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10549555..10550133 187..765 99 <- Minus
chr3L 10550196..10550381 1..186 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:39 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 1..501 67..567 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:04:16 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 1..501 67..567 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:32:49 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 1..501 67..567 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:13 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 1..501 67..567 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:24:17 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 1..501 67..567 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:24:33 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 92..856 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:04:16 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 92..856 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:32:49 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 92..856 1..765 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-28 11:45:34 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 59..823 1..765 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:24:17 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
CG6527-RA 92..856 1..765 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:54 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10558165..10558743 187..765 99 <- Minus
3L 10558806..10558991 1..186 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:54 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10558165..10558743 187..765 99 <- Minus
3L 10558806..10558991 1..186 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:13:54 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10558165..10558743 187..765 99 <- Minus
3L 10558806..10558991 1..186 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:32:49 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10551265..10551843 187..765 99 <- Minus
arm_3L 10551906..10552091 1..186 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:32:37 Download gff for FI08415.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10551906..10552091 1..186 98   Minus
3L 10551265..10551843 187..765 99 <- Minus

FI08415.hyp Sequence

Translation from 0 to 566

> FI08415.hyp
IQILSKCKKYFTNSFSNSFLTNMSANSNSLEISPNSTLTFTKTNNKHEIT
IKNVGEKTVTYKVQCTVHGKFNIKPRWGVLSPNEHSHVLITMCKDVELSR
KGRDKIVVVCMVSPINAVDFEMTASFWRHNICYDPSIEKHQLTCHQMDGA
GEGHGDGGDKDAEPEDLRFRQGLFPSFCSIRTPSKYWR*

FI08415.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG6527-PB 166 CG6527-PB 1..166 23..188 906 100 Plus
CG6527-PA 166 CG6527-PA 1..166 23..188 906 100 Plus
Vap-33B-PB 206 CG33523-PB 2..135 30..163 186 28.4 Plus
Vap-33B-PA 234 CG33523-PA 30..163 30..163 186 28.4 Plus
Vap-33B-PC 240 CG33523-PC 36..169 30..163 186 28.4 Plus

FI08415.pep Sequence

Translation from 0 to 566

> FI08415.pep
IQILSKCKKYFTNSFSNSFLTNMSANSNSLEISPNSTLTFTKTNNKHEIT
IKNVGEKTVTYKVQCTVHGKFNIKPRWGVLSPNEHSHVLITMCKDVELSR
KGRDKIVVVCMVSPINAVDFEMTASFWRHNICYDPSIEKHQLTCHQMDGA
GEGHGDGGDKDAEPEDLRFRQGLFPSFCSIRTPSKYWR*

FI08415.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:17:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23828-PA 176 GF23828-PA 27..176 30..188 451 52.8 Plus
Dana\GF24005-PA 662 GF24005-PA 295..409 30..144 172 27 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13971-PA 166 GG13971-PA 1..166 23..188 738 87.3 Plus
Dere\GG15302-PA 497 GG15302-PA 294..426 30..163 168 27.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14689-PA 482 GH14689-PA 277..422 24..170 186 27.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG6527-PB 166 CG6527-PB 1..166 23..188 906 100 Plus
CG6527-PA 166 CG6527-PA 1..166 23..188 906 100 Plus
CG33523-PB 206 CG33523-PB 2..135 30..163 186 28.4 Plus
CG33523-PA 234 CG33523-PA 30..163 30..163 186 28.4 Plus
CG33523-PC 240 CG33523-PC 36..169 30..163 186 28.4 Plus
CG33523-PD 498 CG33523-PD 294..427 30..163 186 28.4 Plus
CG33523-PF 654 CG33523-PF 294..427 30..163 186 28.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13304-PA 504 GI13304-PA 300..421 30..152 179 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15594-PA 142 GL15594-PA 3..130 27..152 338 48.4 Plus
Dper\GL21079-PA 498 GL21079-PA 296..420 30..155 191 31 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:17:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19665-PA 142 GA19665-PA 3..130 27..152 337 48.4 Plus
Dpse\GA28323-PA 498 GA28323-PA 296..410 30..145 192 31.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24808-PA 162 GM24808-PA 1..162 23..188 798 91 Plus
Dsec\GM14735-PA 497 GM14735-PA 293..426 30..163 181 27.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13915-PA 240 GD13915-PA 36..169 30..163 186 28.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12072-PA 487 GJ12072-PA 301..415 30..144 179 29.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:18:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12362-PA 144 GK12362-PA 4..135 28..157 303 42.4 Plus
Dwil\GK16664-PA 638 GK16664-PA 318..433 40..151 164 35.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20270-PA 174 GE20270-PA 1..174 23..188 772 81 Plus
Dyak\GE21523-PA 641 GE21523-PA 294..409 30..145 185 29.3 Plus