Clone FI08416 Report

Search the DGRC for FI08416

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:84
Well:16
Vector:pOTB7
Associated Gene/TranscriptCG17237-RA
Protein status:FI08416.pep: gold
Sequenced Size:888

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17237 2008-08-15 Release 5.9 accounting
CG17237 2008-12-18 5.12 accounting

Clone Sequence Records

FI08416.complete Sequence

888 bp assembled on 2008-07-29

GenBank Submission: BT044402.1

> FI08416.complete
GTCCGGCGTAATCATATTTCTGTGTCTTCCAATCATTGTTTTCCATTTTC
CCGAAAGCATGTGTATCACTTAACAGCAAACATAAAATAGATTGTTGGCT
GCACACGTCCATCCCGAAATCCGTAATCCATAAACCGTGAACGTTACTCG
TACAACCGATCCAATGATGTCCAGGAAAGGCAATCAACTCCACCCGTCAT
CAATCCGTCCATCATCGACCACACCGGACTGCAATCAGAAGCGGCGAGGC
GACATGACAGCTCCTCCTCCGAACCCAAAGCCAGAGAAAAGCCGCATCAT
GGAGATGCATGCGATTTTTCTGGGGCACGACACTCGCGGCGACAATAAGA
TATCCATCCGGCACCTGGGCCATTGTCTGCGTGCGATGGGCGCCACTCCC
ACGGAGGCGATGGTCAGCAAACATGTCCGCCAGTACGAGGCCTCCACCAT
GCAGCGCATATGCTTCGATGAGGTCATGGGCATCTACTCCAGTCTTGGCA
AGCACGGCGGCATGTTGTCTCCCAAGAAAAAACAGATCGAGGCGGACCAG
TTCGTATCCAGTCTAAGGGTCTTTGATACGGATAAGTCCGGTTGGATTCC
CGCCATCAGACTCCGGCGCATTCTAACCAAGACCGGGGAGTGCATGGGCA
GCATGGAAGTGGACGAGCTGCTCCAGGGTAGGATCAACAAAGACGGCTTG
GTCGACTACAAGAAGCTGGTTCAAGACATTATCTATGGGTAACTTGGGGG
AAATCAAAAGGAAAGGAGAGTCATTCAGAGGAGCTGGAAATGGAAGAATA
GCCCGGAAAACAAACCATATTTAGACAGGTGAAAAATGTGTTTCAAATAA
ATGTTTGTTTAAAACCCCAAAAAAAAAAAAAAAAAAAA

FI08416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17237-RA 876 CG17237-RA 1..871 1..871 4295 99.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:40:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2288243..2289110 868..1 4310 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2288500..2289370 871..1 4295 99.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:23:33
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2288500..2289370 871..1 4295 99.5 Minus
Blast to na_te.dros performed on 2019-03-15 23:40:06 has no hits.

FI08416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:40:51 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2288243..2289110 1..868 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:41 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..579 164..742 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:07:33 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..579 164..742 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:23 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..579 164..742 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:34 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..579 164..742 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:45:06 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..579 164..742 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:32:46 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..868 1..868 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:07:32 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..868 1..868 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:23 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 47..914 1..868 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 09:21:07 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 1..868 1..868 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:45:06 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
CG17237-RA 47..914 1..868 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:51 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2288503..2289370 1..868 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:51 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2288503..2289370 1..868 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:40:51 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2288503..2289370 1..868 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:23 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2288503..2289370 1..868 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:36:51 Download gff for FI08416.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2288503..2289370 1..868 99   Minus

FI08416.pep Sequence

Translation from 163 to 741

> FI08416.pep
MMSRKGNQLHPSSIRPSSTTPDCNQKRRGDMTAPPPNPKPEKSRIMEMHA
IFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRIC
FDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRL
RRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDIIYG*

FI08416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15287-PA 202 GF15287-PA 1..202 2..192 473 47.8 Plus
Dana\GF21286-PA 147 GF21286-PA 6..147 42..192 226 33.8 Plus
Dana\GF12835-PA 149 GF12835-PA 7..143 42..186 188 30.6 Plus
Dana\GF16770-PA 165 GF16770-PA 5..160 30..187 172 28 Plus
Dana\GF16772-PA 148 GF16772-PA 6..142 42..186 158 24.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:19:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24532-PA 193 GG24532-PA 1..193 2..192 781 79.3 Plus
Dere\GG18489-PA 147 GG18489-PA 6..147 42..192 226 33.8 Plus
Dere\GG20265-PA 149 GG20265-PA 7..143 42..186 188 30.6 Plus
Dere\GG11425-PA 148 GG11425-PA 6..142 42..186 161 25.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13789-PA 158 GH13789-PA 7..155 40..189 282 40.4 Plus
Dgri\GH24922-PA 158 GH24922-PA 17..158 42..192 221 33.8 Plus
Dgri\GH23405-PA 151 GH23405-PA 4..145 37..186 151 23.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG17237-PA 192 CG17237-PA 1..192 1..192 1011 100 Plus
Mlc-c-PA 147 CG3201-PA 6..147 42..192 220 33.8 Plus
Mlc-c-PB 153 CG3201-PB 17..153 47..192 217 34.9 Plus
Cam-PD 149 CG8472-PD 7..143 42..186 172 30.6 Plus
Cam-PC 149 CG8472-PC 7..143 42..186 172 30.6 Plus
Cam-PE 149 CG8472-PE 7..143 42..186 172 30.6 Plus
Cam-PB 149 CG8472-PB 7..143 42..186 172 30.6 Plus
Cam-PA 149 CG8472-PA 7..143 42..186 172 30.6 Plus
Acam-PB 148 CG17769-PB 6..142 42..186 155 26 Plus
Acam-PA 148 CG17769-PA 6..142 42..186 155 26 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14158-PA 159 GI14158-PA 4..155 39..189 255 36.9 Plus
Dmoj\GI21775-PA 153 GI21775-PA 9..153 39..192 231 34.4 Plus
Dmoj\GI20594-PA 149 GI20594-PA 7..143 42..186 188 30.6 Plus
Dmoj\GI10339-PA 149 GI10339-PA 2..143 37..186 156 24.7 Plus
Dmoj\GI10340-PA 150 GI10340-PA 8..144 42..186 141 20.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19406-PA 161 GL19406-PA 2..160 35..190 330 39.6 Plus
Dper\GL16470-PA 153 GL16470-PA 9..153 39..192 232 34.4 Plus
Dper\GL10814-PA 149 GL10814-PA 7..143 42..186 188 30.6 Plus
Dper\GL21535-PA 148 GL21535-PA 6..142 42..186 151 27.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14407-PA 161 GA14407-PA 2..160 35..190 334 40.3 Plus
Dpse\GA22593-PA 153 GA22593-PA 9..153 39..192 232 34.4 Plus
Dpse\GA24499-PA 149 GA24499-PA 7..143 42..186 188 30.6 Plus
Dpse\GA14657-PA 148 GA14657-PA 6..142 42..186 151 27.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18240-PA 191 GM18240-PA 1..191 2..192 933 90.6 Plus
Dsec\GM12637-PA 147 GM12637-PA 6..147 42..192 226 33.8 Plus
Dsec\GM21351-PA 149 GM21351-PA 7..143 42..186 188 30.6 Plus
Dsec\GM10265-PA 148 GM10265-PA 6..142 42..186 169 26 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22845-PA 132 GD22845-PA 1..129 2..130 634 90.7 Plus
Dsim\GD16253-PA 147 GD16253-PA 6..147 42..192 226 33.8 Plus
Dsim\GD10849-PA 149 GD10849-PA 7..143 42..186 188 30.6 Plus
Dsim\GD21235-PA 148 GD21235-PA 6..142 42..186 169 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22292-PA 168 GJ22292-PA 12..153 47..189 271 39.9 Plus
Dvir\GJ16948-PA 146 GJ16948-PA 5..146 42..192 226 33.8 Plus
Dvir\GJ10192-PA 166 GJ10192-PA 6..160 30..186 150 25.6 Plus
Dvir\GJ20779-PA 113 GJ20779-PA 1..107 72..186 149 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14989-PA 174 GK14989-PA 34..174 51..192 315 43.7 Plus
Dwil\GK24961-PA 619 GK24961-PA 445..619 4..192 248 31.2 Plus
Dwil\GK22183-PA 149 GK22183-PA 7..143 42..186 188 30.6 Plus
Dwil\GK18988-PA 148 GK18988-PA 6..142 42..186 158 25.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15137-PA 198 GE15137-PA 1..198 2..192 758 76.8 Plus
Dyak\GE16807-PA 147 GE16807-PA 6..147 42..192 226 33.8 Plus
Dyak\Cam-PA 149 GE12425-PA 7..143 42..186 188 30.6 Plus
Dyak\GE23620-PA 148 GE23620-PA 6..142 42..186 164 25.3 Plus

FI08416.hyp Sequence

Translation from 163 to 741

> FI08416.hyp
MMSRKGNQLHPSSIRPSSTTPDCNQKRRGDMTAPPPNPKPEKSRIMEMHA
IFLGHDTRGDNKISIRHLGHCLRAMGATPTEAMVSKHVRQYEASTMQRIC
FDEVMGIYSSLGKHGGMLSPKKKQIEADQFVSSLRVFDTDKSGWIPAIRL
RRILTKTGECMGSMEVDELLQGRINKDGLVDYKKLVQDIIYG*

FI08416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG17237-PA 192 CG17237-PA 1..192 1..192 1011 100 Plus
Mlc-c-PA 147 CG3201-PA 6..147 42..192 220 33.8 Plus
Mlc-c-PB 153 CG3201-PB 17..153 47..192 217 34.9 Plus
Cam-PD 149 CG8472-PD 7..143 42..186 172 30.6 Plus
Cam-PC 149 CG8472-PC 7..143 42..186 172 30.6 Plus