Clone FI08418 Report

Search the DGRC for FI08418

Clone and Library Details

Library:FI
Tissue Source:various Drosophila melanogaster
Created by: 
Date Registered:2005-11-08
Comments:Drosophila melanogaster corrected cDNA clones
Original Plate Number:84
Well:18
Vector:pOTB7
Associated Gene/TranscriptCG13759-RA
Protein status:FI08418.pep: gold
Sequenced Size:976

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13759 2008-08-15 Release 5.9 accounting
CG13759 2008-12-18 5.12 accounting

Clone Sequence Records

FI08418.complete Sequence

976 bp assembled on 2008-07-29

GenBank Submission: BT044404.1

> FI08418.complete
CATTGGGGCAACACAAAGAATAGTGAAAGTGCAGTGGGAGCGAGCGAGAG
GCAAGAGGTCGAGAGTTGAAAGGACAGGCAGAGAGTTGCGACTAATTGAG
TTATAGGAAAAGAGTACCCACATATCTTCTTTACCATCCGCAGACAATTC
GGCGATTGCAGCGGCTGTGACACCATGGAGTACAAGATGATTGCACCAGA
GCACAGTGAACAGGTGATGGAGCATCTGCGGCGCAACTTCTTTGCCGACG
AGCCGCTAAACAAGGCCGCCGGCTTGTGCCAGAACGGCAGCAGTTGCCCC
GCCCTGGAGGCGCACTGTGCCGAGGCCATACAGCACCGGATGAGCGTGAT
GGCTGTGGACGCAAAGGAGAAGGATACCTTGAAAATAGTCGGCGTCGTCC
TCAATGGCATCCTGAAGCCGGGCGACACGGCCAAGGCGCTGAGCAAGCTG
GACTGCAACGACGATGCAGATTTCCGCAAGATTTTCGACTTGCTGCACAG
GCACAATCTCAAGCACAATCTCTTCGAGCACTTCGACGTGGACTGCATGT
TCGATGTGCGCATCCTATCGGTGGACTCGTGCTACCGTGGCCAGGGGATT
GCGAATGAGCTGGTCAAGCGGTCCGTGGCGGTGGCCAAAAAGAATGGCTT
TCGCCTGCTGAAGGCCGATGCCACCGGCATCTTCTCGCAGAAGATCTTTC
GTTCCCATGGCTTTGAGGTCTTCTCGGAGCAACCCTACAGCAAGTATACG
GATGAGAATGGCAAGGTGATCTTGCCCGTGGAGGCGCCCCACATCAAATT
GCAGCAGCTCTACAAGGCGATCTGTGCGGATGACCAGGATGAGAAGAAGC
AGTCGCTTTAAGGAGTCACCCGGCTGGCTCACATTTGGAACAATAATCTC
ATTTATTTTCTACATATACATACATTGCATAATCGTTATTGGAATGTTTT
CGTACTACAAAAAAAAAAAAAAAAAA

FI08418.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG13759-RA 976 CG13759-RA 19..976 1..958 4760 99.7 Plus
CG13759.b 1043 CG13759.b 194..1031 124..961 4160 99.7 Plus
CG13759.c 956 CG13759.c 142..956 144..958 4045 99.7 Plus
CG13759.c 956 CG13759.c 19..142 1..124 620 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2476778..2477619 117..958 4180 99.8 Plus
chrX 22417052 chrX 2476493..2476615 1..123 615 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 16:20:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:15:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2582982..2583826 117..961 4165 99.5 Plus
X 23542271 X 2582704..2582826 1..123 615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:24:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2591080..2591924 117..961 4165 99.5 Plus
X 23527363 X 2590802..2590924 1..123 615 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:15:36 has no hits.

FI08418.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:16:20 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2476493..2476615 1..123 100 -> Plus
chrX 2476785..2477619 124..958 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 15:58:44 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RA 1..687 175..861 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:08:19 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RC 1..687 175..861 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:58:56 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RB 1..687 175..861 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-09-08 12:18:50 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RA 1..687 175..861 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:19 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RB 1..687 175..861 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:34:16 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RA 1..958 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:08:19 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RA 1..958 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:58:56 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RA 1..958 1..958 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-29 13:02:00 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RA 1..958 1..958 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:19 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
CG13759-RA 1..958 1..958 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:20 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
X 2582704..2582826 1..123 100 -> Plus
X 2582989..2583823 124..958 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:20 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
X 2582704..2582826 1..123 100 -> Plus
X 2582989..2583823 124..958 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:16:20 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
X 2582704..2582826 1..123 100 -> Plus
X 2582989..2583823 124..958 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:58:56 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2476737..2476859 1..123 100 -> Plus
arm_X 2477022..2477856 124..958 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:37:49 Download gff for FI08418.complete
Subject Subject Range Query Range Percent Splice Strand
X 2591087..2591921 124..958 99   Plus
X 2590802..2590924 1..123 100 -> Plus

FI08418.pep Sequence

Translation from 174 to 860

> FI08418.pep
MEYKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAE
AIQHRMSVMAVDAKEKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADF
RKIFDLLHRHNLKHNLFEHFDVDCMFDVRILSVDSCYRGQGIANELVKRS
VAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTDENGKVIL
PVEAPHIKLQQLYKAICADDQDEKKQSL*

FI08418.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:31:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22216-PA 229 GF22216-PA 1..227 1..225 920 77.1 Plus
Dana\GF11376-PA 275 GF11376-PA 58..275 4..228 232 31.3 Plus
Dana\GF14512-PA 219 GF14512-PA 21..211 18..208 194 29.8 Plus
Dana\GF24634-PA 222 GF24634-PA 12..212 4..206 178 26.7 Plus
Dana\GF21065-PA 215 GF21065-PA 4..209 1..210 175 25.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12937-PA 231 GG12937-PA 1..230 1..227 1070 87.8 Plus
Dere\GG22946-PA 275 GG22946-PA 60..265 4..216 232 30.7 Plus
Dere\GG10399-PA 216 GG10399-PA 12..206 9..206 173 26.5 Plus
Dere\GG21595-PA 222 GG21595-PA 12..212 4..206 165 23.6 Plus
Dere\GG21596-PA 222 GG21596-PA 12..218 4..212 165 23.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:31:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11973-PA 226 GH11973-PA 1..218 1..216 684 61 Plus
Dgri\GH19975-PA 277 GH19975-PA 62..268 4..216 213 27.2 Plus
Dgri\GH11000-PA 211 GH11000-PA 5..203 10..208 198 28.6 Plus
Dgri\GH10999-PA 223 GH10999-PA 22..219 12..212 191 27.3 Plus
Dgri\GH11001-PA 214 GH11001-PA 14..206 12..208 163 24.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
AANATL7-PD 228 CG13759-PD 1..228 1..228 1191 100 Plus
AANATL7-PC 228 CG13759-PC 1..228 1..228 1191 100 Plus
AANATL7-PB 228 CG13759-PB 1..228 1..228 1191 100 Plus
AANATL7-PA 228 CG13759-PA 1..228 1..228 1191 100 Plus
AANAT1-PA 240 CG3318-PA 25..230 4..216 234 29.5 Plus
AANAT1-PB 275 CG3318-PB 60..265 4..216 234 29.5 Plus
AANATL4-PA 224 CG18607-PA 12..218 4..210 207 28.7 Plus
AANATL3-PA 222 CG10659-PA 12..212 4..206 175 25.1 Plus
AANATL2-PB 216 CG9486-PB 15..206 12..206 172 25.5 Plus
AANATL2-PA 216 CG9486-PA 15..206 12..206 172 25.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14714-PA 223 GI14714-PA 1..223 1..221 703 59.2 Plus
Dmoj\GI20262-PA 264 GI20262-PA 54..257 4..216 228 29 Plus
Dmoj\GI17517-PA 224 GI17517-PA 31..218 21..210 199 28.1 Plus
Dmoj\GI17524-PA 222 GI17524-PA 31..218 21..212 193 29.1 Plus
Dmoj\GI17518-PA 213 GI17518-PA 20..205 18..208 192 28.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:31:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14179-PA 229 GL14179-PA 1..229 1..226 780 64.6 Plus
Dper\GL17369-PA 290 GL17369-PA 73..290 4..228 258 32 Plus
Dper\GL25512-PA 221 GL25512-PA 14..213 9..208 191 28.7 Plus
Dper\GL11101-PA 224 GL11101-PA 14..214 4..206 184 25.6 Plus
Dper\GL26282-PA 225 GL26282-PA 66..221 58..212 144 26.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12509-PA 229 GA12509-PA 1..229 1..226 780 64.6 Plus
Dpse\GA17346-PA 290 GA17346-PA 73..290 4..228 258 32 Plus
Dpse\GA21823-PA 221 GA21823-PA 14..211 9..206 193 29.5 Plus
Dpse\GA24612-PA 224 GA24612-PA 14..214 4..206 185 25.6 Plus
Dpse\GA28106-PA 219 GA28106-PA 26..215 18..212 147 23.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19229-PA 228 GM19229-PA 1..228 1..228 1174 96.5 Plus
Dsec\GM21944-PA 224 GM21944-PA 12..220 4..212 222 28.9 Plus
Dsec\GM18616-PA 216 GM18616-PA 15..206 12..206 185 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:31:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16609-PA 272 GD16609-PA 45..272 1..228 1172 96.5 Plus
Dsim\GD11441-PA 224 GD11441-PA 12..220 4..212 223 28.4 Plus
Dsim\Dat-PA 241 GD15464-PA 60..241 4..190 210 31.2 Plus
Dsim\GD23397-PA 216 GD23397-PA 15..206 12..206 189 27.4 Plus
Dsim\GD21720-PA 222 GD21720-PA 12..212 4..206 168 25.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16779-PA 232 GJ16779-PA 1..218 1..216 678 59.6 Plus
Dvir\GJ15323-PA 217 GJ15323-PA 14..209 12..208 228 30.3 Plus
Dvir\GJ20215-PA 275 GJ20215-PA 61..275 4..228 225 28.6 Plus
Dvir\GJ15334-PA 232 GJ15334-PA 20..220 18..212 212 29.1 Plus
Dvir\GJ15344-PA 215 GJ15344-PA 21..207 18..208 190 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10244-PA 231 GK10244-PA 1..223 1..224 623 55.4 Plus
Dwil\GK23036-PA 273 GK23036-PA 62..267 4..216 222 28.9 Plus
Dwil\GK15375-PA 223 GK15375-PA 12..217 4..210 181 28.1 Plus
Dwil\GK10929-PA 208 GK10929-PA 4..202 9..210 180 25.7 Plus
Dwil\GK14749-PA 226 GK14749-PA 22..218 9..208 180 27.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:31:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16262-PA 231 GE16262-PA 1..230 1..227 1053 87.4 Plus
Dyak\GE14383-PA 275 GE14383-PA 60..265 4..216 237 30 Plus
Dyak\GE12035-PA 219 GE12035-PA 7..215 4..212 205 26.5 Plus
Dyak\GE13747-PA 216 GE13747-PA 15..206 12..206 178 26.9 Plus
Dyak\GE12614-PA 222 GE12614-PA 26..212 18..206 174 24.9 Plus

FI08418.hyp Sequence

Translation from 174 to 860

> FI08418.hyp
MEYKMIAPEHSEQVMEHLRRNFFADEPLNKAAGLCQNGSSCPALEAHCAE
AIQHRMSVMAVDAKEKDTLKIVGVVLNGILKPGDTAKALSKLDCNDDADF
RKIFDLLHRHNLKHNLFEHFDVDCMFDVRILSVDSCYRGQGIANELVKRS
VAVAKKNGFRLLKADATGIFSQKIFRSHGFEVFSEQPYSKYTDENGKVIL
PVEAPHIKLQQLYKAICADDQDEKKQSL*

FI08418.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 23:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13759-PD 228 CG13759-PD 1..228 1..228 1191 100 Plus
CG13759-PC 228 CG13759-PC 1..228 1..228 1191 100 Plus
CG13759-PB 228 CG13759-PB 1..228 1..228 1191 100 Plus
CG13759-PA 228 CG13759-PA 1..228 1..228 1191 100 Plus
Dat-PA 240 CG3318-PA 25..230 4..216 234 29.5 Plus